Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.07
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 3.0e-03
osteosarcoma 7933 3.7e-03

 GO Function (1)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPIPQGFSCLSRFLGWWFRQPVLVTQSAAIVPVRTKKRFTPPIYQPKFKTEKEFMQHARKAGLVIPPE      1 - 70
KSDRSIHLACTAGIFDAYVPPEGDARISSLSKEGLIERTERMKKTMASQVSIRRIKDYDANFKIKDFPEK     71 - 140
AKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMTWDIKYKTVRWSFVESLEPSHVVQVRCSSMMNQGNVYG    141 - 210
QITVRMHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKIVPPWAPPKQPILKTV    211 - 280
MIPGPQLKPEEEYEEAQGEAQKPQLA                                                281 - 306
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551941 2001 The large subunit of the mammalian mitochondrial ribosome. Analysis of the complement of ribosomal proteins present.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.