Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 2.000 2.1e-05
pancreatic ductal adenocarcinoma liver m... -1.115 1.4e-02

Gene RIF (1)

AA Sequence

MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQ      1 - 70
RHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEG     71 - 140
TFKLVAML                                                                  141 - 148
//

Text Mined References (16)

PMID Year Title