Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 1.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 1.6e-06
acute myeloid leukemia 783 2.7e-02
osteosarcoma 7950 4.8e-02
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.9
Mental Depression 333 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.300 2.7e-02
Breast cancer 1.100 1.6e-06
osteosarcoma 1.077 4.8e-02

Synonym

Accession Q6P1L8 B2R575 Q96Q72 L14mt
Symbols L14mt
L32mt
MRPL32
RMPL32
RPML32
MRP-L14
MRP-L32

Gene

PDB

3J9M   3J7Y   5OOL   5OOM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAFFTGLWGPFTCVSRVLSHHCFSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVG      1 - 70
DQILLAIKGQKKKALIVGHCMPGPRMTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRKREGEYSKVLAI     71 - 140
AQNFV                                                                     141 - 145
//

Text Mined References (20)

PMID Year Title