Property Summary

Ligand Count 4
NCBI Gene PubMed Count 16
PubMed Score 35.20
PubTator Score 17.94

Knowledge Summary

Patent (2,676)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.7e-05
Disease Target Count Z-score Confidence
Urticaria 67 3.905 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.077 3.7e-05

Gene RIF (9)

AA Sequence

MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLS      1 - 70
LAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCR     71 - 140
RPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRIL    141 - 210
CGSRGLPLTRLYLTILLTVLVFLLCGLPFGIQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYF    211 - 280
FVGSFRKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQGTPEMSRSSLV                        281 - 330
//

Text Mined References (20)

PMID Year Title