Property Summary

Ligand Count 3
NCBI Gene PubMed Count 8
PubMed Score 18.42
PubTator Score 14.84

Knowledge Summary

Patent (4,349)

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.0e-11
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rosacea 25 3.799 1.9

Gene RIF (2)

AA Sequence

MDPTISTLDTELTPINGTEETLCYKQTLSLTVLTCIVSLVGLTGNAVVLWLLGCRMRRNAFSIYILNLAA      1 - 70
ADFLFLSGRLIYSLLSFISIPHTISKILYPVMMFSYFAGLSFLSAVSTERCLSVLWPIWYRCHRPTHLSA     71 - 140
VVCVLLWALSLLRSILEWMLCGFLFSGADSAWCQTSDFITVAWLIFLCVVLCGSSLVLLIRILCGSRKIP    141 - 210
LTRLYVTILLTVLVFLLCGLPFGIQFFLFLWIHVDREVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQ    211 - 280
RQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ                                281 - 322
//

Text Mined References (11)

PMID Year Title