Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1.13
PubTator Score 138.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.200 1.1e-06
cutaneous lupus erythematosus 1.100 8.1e-03
ependymoma 1.200 7.6e-08
glioblastoma 1.100 1.5e-03
Hydrolethalus syndrome 1.027 2.8e-02
intraductal papillary-mucinous adenoma (... 1.800 2.9e-04
intraductal papillary-mucinous neoplasm ... 1.700 6.6e-04
lung cancer -1.400 1.9e-02
lung carcinoma -1.300 6.2e-16
malignant mesothelioma -3.500 2.0e-08
medulloblastoma, large-cell -2.200 4.7e-04
Multiple myeloma 1.466 8.2e-03
osteosarcoma -1.279 1.7e-02
ovarian cancer -2.400 2.7e-07
subependymal giant cell astrocytoma 1.223 3.3e-02

Gene RIF (26)

AA Sequence

MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAP      1 - 70
WMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQD     71 - 140
FLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNR    141 - 210
KETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHV    211 - 280
EHCGVHMVLQVPQESETIPLVMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDR             281 - 341
//

Text Mined References (35)

PMID Year Title