Property Summary

NCBI Gene PubMed Count 7
PubMed Score 8.43
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.200 2.9e-04
atypical teratoid / rhabdoid tumor -2.000 7.3e-05
glioblastoma -1.100 4.0e-02
intraductal papillary-mucinous carcinoma... -1.600 3.2e-02
intraductal papillary-mucinous neoplasm ... -2.300 8.5e-03
lung carcinoma 1.800 1.1e-24
medulloblastoma, large-cell 1.500 1.9e-06
osteosarcoma 1.301 4.1e-05
ovarian cancer 1.600 4.1e-14
pancreatic cancer -1.100 2.2e-03

 GO Function (1)

Gene RIF (1)

AA Sequence

MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRRVATLVVTFHANFNYVWLRLL      1 - 70
ERALPGRAPHALLAKLLCDQVVGAPIAVSAFYVGMSILQGKDDIFLDLKQKFWNTYLSGLMYWPFVQLTN     71 - 140
FSLVPVQWRTAYAGVCGFLWATFICFSQQSGDGTFKSAFTILYTKGTSATEGYPKK                  141 - 196
//

Text Mined References (8)

PMID Year Title