Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.46
PubTator Score 12.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 5.9e-05
osteosarcoma -1.687 6.5e-06
glioblastoma -1.300 2.2e-07
intraductal papillary-mucinous adenoma (... 1.100 5.0e-03
aldosterone-producing adenoma -1.138 4.0e-02
ovarian cancer -2.600 2.0e-10

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
488946 summary 0 / 0 / 0 Probe Summary Assay for Inhibitors for MPP8 Chromodomain Interactions with Methylated Histone Tails
488949 confirmatory 195 / 256 / 2109 qHTS Validation Assay for Inhibitors for MPP8 Chromodomain Interactions with Methylated Histone Tails

Gene RIF (8)

PMID Text
26022416 this study identified the HUSH (human silencing hub) complex, comprising three poorly characterized proteins, TASOR, MPP8, and periphilin; this complex is absent from Drosophila but is conserved from fish to humans.
25870236 findings demonstrate MPP8 and SIRT1 reciprocally regulate each other's function at multiple molecular layers through physical interaction; disruption of MPP8-SIRT1 interaction de-represses E cadherin expression and reduces cell motility and invasiveness suggesting this interplay plays critical role in MPP8- and SIRT1-mediated epithelial-mesenchymal transition
25660450 Knockdown analysis of MPP8 in HeLa cells resulted in derepression of a set of genes that are normally expressed in spermatogonia, spermatids and mature sperm, thereby indicating a role for this molecule in silencing testis-related genes in somatic cells.
23532874 interaction of HN with MPP8 may play a role in oncogenesis because MPP8 increases tumor cell motility and invasion
23416073 these results indicate that the chromatin association of MPP8 is regulated by Cdk-dependent phosphorylation.
22022377 These findings reveal the molecular mechanism of selective binding of human MPP8 chromodomain to methylated histone H3K9.
21419134 We determined the crystal structure of MPP8 chromodomain in complex with H3K9me3 peptide. MPP8 interacts with at least six histone H3 residues from glutamine 5 to serine 10.
20871592 MPP8 mediates E-cadherin gene silencing and promotes breast tumour cell motility and invasion.

AA Sequence

MEQVAEGARVTAVPVSAADSTEELAEVEEGVGVVGEDNDAAARGAEAFGDSEEDGEDVFEVEKILDMKTE      1 - 70
GGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAKAVRKDIQRLSLNNDIFEANSDSDQ     71 - 140
QSETKEDTSPKKKKKKLRQREEKSPDDLKKKKAKAGKLKDKSKPDLESSLESLVFDLRTKKRISEAKEEL    141 - 210
KESKKPKKDEVKETKELKKVKKGEIRDLKTKTREDPKENRKTKKEKFVESQVESESSVLNDSPFPEDDSE    211 - 280
GLHSDSREEKQNTKSARERAGQDMGLEHGFEKPLDSAMSAEEDTDVRGRRKKKTPRKAEDTRENRKLENK    281 - 350
NAFLEKKTVPKKQRNQDRSKSAAELEKLMPVSAQTPKGRRLSGEERGLWSTDSAEEDKETKRNESKEKYQ    351 - 420
KRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSL    421 - 490
KERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGRQQILSLGMDLQLEWMKLEDFQKHLDGKDENFA    491 - 560
ATDAIPSNVLRDAVKNGDYITVKVALNSNEEYNLDQEDSSGMTLVMLAAAGGQDDLLRLLITKGAKVNGR    561 - 630
QKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQ    631 - 700
NSALHFAKQSNNVLVYDLLKNHLETLSRVAEETIKDYFEARLALLEPVFPIACHRLCEGPDFSTDFNYKP    701 - 770
PQNIPEGSGILLFIFHANFLGKEVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRL    771 - 840
TEAPSAKVKLLIGAYRVQLQ                                                      841 - 860
//

Text Mined References (31)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26022416 2015 GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells.
25870236 2015 MPP8 and SIRT1 crosstalk in E-cadherin gene silencing and epithelial-mesenchymal transition.
25660450 2015 Physical interaction between MPP8 and PRC1 complex and its implication for regulation of spermatogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23532874 2013 Humanin binds MPP8: mapping interaction sites of the peptide and protein.
23416073 2013 Mitotic phosphorylation of MPP8 by cyclin-dependent kinases regulates chromatin dissociation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22086334 2011 MPP8 mediates the interactions between DNA methyltransferase Dnmt3a and H3K9 methyltransferase GLP/G9a.
22022377 2011 Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9.
21419134 2011 Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9: potential effect of phosphorylation on methyl-lysine binding.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20871592 2010 Methyl-H3K9-binding protein MPP8 mediates E-cadherin gene silencing and promotes tumour cell motility and invasion.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16583711 2006 [Identification of the proteins interacting with neuroprotective peptide humanin in a yeast two-hybrid system].
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12559565 2003 A novel nuclear protein, Twa1, and Muskelin comprise a complex with RanBPM.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8885239 1996 Identification of novel M phase phosphoproteins by expression cloning.