Property Summary

NCBI Gene PubMed Count 37
PubMed Score 42.59
PubTator Score 36.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

 GO Function (1)

Gene RIF (19)

PMID Text
25675348 The replication association of rs1324183 (MPDZ-NF1B) with KC in our population and the results, which are identical to those in different populations, suggest that rs1324183 (MPDZ-NF1B) is a common genetic risk for Keratoconus.
23880463 MUPP-1 controls the PALS-1/PATJ complex levels at the post-translational level.
23240096 Our data strongly support the candidacy of MPDZ as a novel congenital hydrocephalus disease gene.
21762291 The data indicates potential association between variation in mpdz NMDA dependent AMPA trafficking and alcohol dependence.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19483657 These data suggest that NMDA receptor complex formation, localization, and downstream signaling may be abnormal in schizophrenia as PSD95, SynGAP and MUPP1 expression is altered.
19420109 MUPP1 and Kir4.2 may participate in a protein complex in the nephron that could regulate transport of K(+) as well as other ions.
19255144 Results suggest that signaling mediated by Pals1, which has a higher affinity for Patj than for MUPP1 and is involved in the activation of the Par6-aPKC complex, is of principal importance for the function of Patj in epithelial cells.
19175764 Exploratory haplotype and single nucleotide polymorphisms association analyses suggest a possible association between the MPDZ gene and alcohol dependence but not alcohol withdrawal seizures.
19175764 Observational study of gene-disease association. (HuGE Navigator)
19071123 An interaction between the human somatostatin receptor 3 and the multiple PDZ protein MUPP1 was identified.
18854154 Knockdown of multiple PDZ domain protein (MPDZ) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18378672 MUPP1 binds to the G protein-coupled MT(1) melatonin receptor and directly regulates its G(i)-dependent signal transduction
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 39 is discussed
16452527 The predominant expression profile of MUPP1 in sperm in the apical acrosomal region of different mammalian species suggests that this PDZ-domain protein may be involved in organizing signaling molecules mediating primary reactions of fertilization.
16452527 The results revealed prominent MUPP1 expression which was restricted to the apical acrosomal region and, most notably, to the equatorial segment of the acrosome[MUPP1]
15364909 Results indicate that the coxsackievirus and adenovirus receptor interacts with multi-PDZ domain protein 1 (MUPP1) and is involved in MUPP1 recruitment to the tight junction.

AA Sequence

MLEAIDKNRALHAAERLQTKLRERGDVANEDKLSLLKSVLQSPLFSQILSLQTSVQQLKDQVNIATSATS      1 - 70
NIEYAHVPHLSPAVIPTLQNESFLLSPNNGNLEALTGPGIPHINGKPACDEFDQLIKNMAQGRHVEVFEL     71 - 140
LKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQ    141 - 210
KAKDTVQLVIARGSLPQLVSPIVSRSPSAASTISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKATGVI    211 - 280
VKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGIT    281 - 350
LSSSPTSTPELRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDG    351 - 420
RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDADLSPVNASII    421 - 490
KENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFS    491 - 560
ENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVC    561 - 630
CRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQH    631 - 700
IELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEA    701 - 770
LKGAPSGTVRIGVAKPLPLSPEEGYVSAKEDSFLYPPHSCEEAGLADKPLFRADLALVGTNDADLVDEST    771 - 840
FESPYSPENDSIYSTQASILSLHGSSCGDGLNYGSSLPSSPPKDVIENSCDPVLDLHMSLEELYTQNLLQ    841 - 910
RQDENTPSVDISMGPASGFTINDYTPANAIEQQYECENTIVWTESHLPSEVISSAELPSVLPDSAGKGSE    911 - 980
YLLEQSSLACNAECVMLQNVSKESFERTINIAKGNSSLGMTVSANKDGLGMIVRSIIHGGAISRDGRIAI    981 - 1050
GDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFKISLGQQSGRVMALDIFSSYTGR   1051 - 1120
DIPELPEREEGEGEESELQNTAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHV   1121 - 1190
LEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYP   1191 - 1260
KYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEF   1261 - 1330
GYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLE   1331 - 1400
INGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPGNAVEPLPSNSENLQNKETEPTVTTSD   1401 - 1470
AAVDLSSFKNVQHLELPKDQGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGY   1471 - 1540
PIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRNTSRSSTP   1541 - 1610
AIFASDPATCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEV   1611 - 1680
NGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVF   1681 - 1750
VSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFHSERRPSQS   1751 - 1820
SQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMKKGPTDSLGISIAGGVGSPLGDVPI   1821 - 1890
FIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEP   1891 - 1960
ASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGR   1961 - 2030
LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLS                                 2031 - 2070
//

Text Mined References (46)

PMID Year Title
25675348 2015 Evaluating the Association between Keratoconus and Reported Genetic Loci in a Han Chinese Population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23880463 2013 The multi-PDZ domain protein-1 (MUPP-1) expression regulates cellular levels of the PALS-1/PATJ polarity complex.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23240096 2013 Mutation in MPDZ causes severe congenital hydrocephalus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22653443 2012 Mutant p53 interactome identifies nardilysin as a p53R273H-specific binding partner that promotes invasion.
21762291 2012 Genetic variability in the NMDA-dependent AMPA trafficking cascade is associated with alcohol dependence.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909339 2009 Olfactory receptor signaling is regulated by the post-synaptic density 95, Drosophila discs large, zona-occludens 1 (PDZ) scaffold multi-PDZ domain protein 1.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19483657 2009 Decreased expression of NMDA receptor-associated proteins in frontal cortex of elderly patients with schizophrenia.
19420109 2009 MUPP1 complexes renal K+ channels to alter cell surface expression and whole cell currents.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19255144 2009 Similar and distinct properties of MUPP1 and Patj, two homologous PDZ domain-containing tight-junction proteins.
19175764 2009 Sequence variations of the human MPDZ gene and association with alcoholism in subjects with European ancestry.
19071123 2009 Interaction of the human somatostatin receptor 3 with the multiple PDZ domain protein MUPP1 enables somatostatin to control permeability of epithelial tight junctions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18378672 2008 The PDZ protein mupp1 promotes Gi coupling and signaling of the Mt1 melatonin receptor.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17384233 2007 Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16452527 The multi PDZ domain protein MUPP1 as a putative scaffolding protein for organizing signaling complexes in the acrosome of mammalian spermatozoa.
16192269 2005 Purification of ATP-binding cassette transporter A1 and associated binding proteins reveals the importance of beta1-syntrophin in cholesterol efflux.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364909 2004 The coxsackievirus and adenovirus receptor interacts with the multi-PDZ domain protein-1 (MUPP-1) within the tight junction.
15316081 2004 Crumbs homologue 1 is required for maintenance of photoreceptor cell polarization and adhesion during light exposure.
15312654 2004 SynGAP-MUPP1-CaMKII synaptic complexes regulate p38 MAP kinase activity and NMDA receptor-dependent synaptic AMPA receptor potentiation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14516276 2003 Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns(3,4)P2-binding adaptor protein TAPP1.
14499480 2003 CLIC6, a member of the intracellular chloride channel family, interacts with dopamine D(2)-like receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403818 2002 Distinct claudins and associated PDZ proteins form different autotypic tight junctions in myelinating Schwann cells.
11802782 2002 Evidence that the tandem-pleckstrin-homology-domain-containing protein TAPP1 interacts with Ptd(3,4)P2 and the multi-PDZ-domain-containing protein MUPP1 in vivo.
11689568 2002 Multi-PDZ domain protein 1 (MUPP1) is concentrated at tight junctions through its possible interaction with claudin-1 and junctional adhesion molecule.
11358867 2001 TEAD/TEF transcription factors utilize the activation domain of YAP65, a Src/Yes-associated protein localized in the cytoplasm.
11150294 2001 Interaction of serotonin 5-hydroxytryptamine type 2C receptors with PDZ10 of the multi-PDZ domain protein MUPP1.
11018522 2000 The direct association of the multiple PDZ domain containing proteins (MUPP-1) with the human c-Kit C-terminus is regulated by tyrosine kinase activity.
11000240 2000 Multi-PDZ domain protein MUPP1 is a cellular target for both adenovirus E4-ORF1 and high-risk papillomavirus type 18 E6 oncoproteins.
10967549 2000 The multi-PDZ domain protein MUPP1 is a cytoplasmic ligand for the membrane-spanning proteoglycan NG2.
9537516 1998 Cloning and characterization of MUPP1, a novel PDZ domain protein.