Property Summary

NCBI Gene PubMed Count 6
PubMed Score 476.35
PubTator Score 85.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
interstitial lung disease 1.500 2.6e-02
malignant mesothelioma -4.600 1.2e-07
astrocytic glioma -2.000 9.3e-03
oligodendroglioma -2.400 7.9e-03
medulloblastoma -2.200 8.2e-06
cystic fibrosis 3.050 2.0e-07
atypical teratoid / rhabdoid tumor -1.400 2.3e-03
medulloblastoma, large-cell -1.900 8.8e-03
adrenocortical carcinoma -2.162 4.8e-04
chronic kidney disease 1.500 3.8e-02
primary pancreatic ductal adenocarcinoma 2.657 1.7e-04
intraductal papillary-mucinous adenoma (... -1.900 6.4e-03
intraductal papillary-mucinous carcinoma... -2.400 3.1e-03
intraductal papillary-mucinous neoplasm ... -2.200 2.0e-02
lung cancer -1.900 1.1e-05
interstitial cystitis -1.200 1.8e-03
adult high grade glioma 2.100 2.0e-02
posterior fossa group A ependymoma 1.700 1.1e-02
psoriasis 1.300 6.4e-39
lung carcinoma -2.400 2.7e-15
Alzheimer's disease -1.500 1.6e-02
Pick disease -1.500 1.1e-03
gastric carcinoma 1.500 3.3e-02
ductal carcinoma in situ 1.500 1.5e-02
ovarian cancer 2.300 1.3e-02
Breast cancer 1.400 7.5e-03
pancreatic cancer 2.500 1.2e-04

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (2)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of monooxygenase, DBH-like 1 (MOXD1) in primary human brain microvascular endothelial cells
15337741 Based on its sequence and localization, MOX (monooxygenase X) is predicted to hydroxylate a hydrophobic substrate in the endoplasmic reticulum.

AA Sequence

MCCWPLLLLWGLLPGTAAGGSGRTYPHRTLLDSEGKYWLGWSQRGSQIAFRLQVRTAGYVGFGFSPTGAM      1 - 70
ASADIVVGGVAHGRPYLQDYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDST     71 - 140
VRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFDLVNQDVPIPNKDTTYWCQMFKI    141 - 210
PVFQEKHHVIKVEPVIQRGHESLVHHILLYQCSNNFNDSVLESGHECYHPNMPDAFLTCETVIFAWAIGG    211 - 280
EGFSYPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHT    281 - 350
IPPGMPEFQSEGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFN    351 - 420
FQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQL    421 - 490
QFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSI    491 - 560
QGMTALPPDIERPYKAEPLVCGTSSSSSLHRDFSINLLVCLLLLSCTLSTKSL                     561 - 613
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337741 2004 Monooxygenase X, a member of the copper-dependent monooxygenase family localized to the endoplasmic reticulum.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9751809 1998 Identification and cloning of a sequence homologue of dopamine beta-hydroxylase.