Property Summary

NCBI Gene PubMed Count 28
PubMed Score 11.31
PubTator Score 517.27

Knowledge Summary

Patent (27,926)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Gene RIF (11)

PMID Text
25512530 approach identified 18 kinase and kinase-related genes whose overexpression can substitute for EGFR in EGFR-dependent PC9 cells, and these genes include seven of nine Src family kinase genes, FGFR1, FGFR2, ITK, NTRK1, NTRK2, MOS, MST1R, and RAF1.
23595635 High methylation level in MOS is associated with intestinal metaplasia.
22252584 among the candidate genes, DNA methylation of MOS may reflect the duration of H. pylori exposure and may be a marker for the development of gastric cancer.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20186124 In the absence of p53, Mos knockdown prevents multipolar mitoses and exerts genome-stabilizing effects.
18550795 Cdc2 and Mos regulate Emi2 stability to promote the meiosis I-meiosis II transition
18246541 Mos 3' UTR regulatory differences underlie species-specific temporal patterns of Mos mRNA cytoplasmic polyadenylation and translational recruitment during oocyte maturation.
18187620 Knockdown of v-mos Moloney murine sarcoma viral oncogene homolog (MOS) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17410130 These results clarify the direct link of the classical Mos-MAPK (mitogen-activated protein kinase) pathway to Erp1 in meiotic arrest of vertebrate oocytes.
16401344 multiple meiotic genes are aberrantly activated during mitotic catastrophe in p53 mutated lymphoma cells after irradiation; the coordinated expression of MOS and REC8 regulate the extent of arrested mitoses and polyploidy
11180847 the Mos/MAPK pathway is not essential for initiating goldfish oocyte maturation despite its general function as a cytostatic factor (CSF).

AA Sequence

MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGG      1 - 70
FGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIME     71 - 140
FGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILIS    141 - 210
EQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYS    211 - 280
GERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG        281 - 346
//

Text Mined References (29)

PMID Year Title
25512530 2014 Genetic modifiers of EGFR dependence in non-small cell lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23595635 2013 Changes in aberrant DNA methylation after Helicobacter pylori eradication: a long-term follow-up study.
22252584 2012 Prediction of the risk for gastric cancer using candidate methylation markers in the non-neoplastic gastric mucosae.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20186124 2010 Multipolar mitosis of tetraploid cells: inhibition by p53 and dependency on Mos.
18550795 2008 Cdc2 and Mos regulate Emi2 stability to promote the meiosis I-meiosis II transition.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18246541 2008 Mos 3' UTR regulatory differences underlie species-specific temporal patterns of Mos mRNA cytoplasmic polyadenylation and translational recruitment during oocyte maturation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17410130 2007 A direct link of the Mos-MAPK pathway to Erp1/Emi2 in meiotic arrest of Xenopus laevis eggs.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16401344 2006 Upregulation of meiosis-specific genes in lymphoma cell lines following genotoxic insult and induction of mitotic catastrophe.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15341746 2004 Mos mediates the mitotic activation of p42 MAPK in Xenopus egg extracts.
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12022922 2002 Identification of protein tyrosine phosphatase 1B and casein as substrates for 124-v-Mos.
11180847 2000 The Mos/MAPK pathway is involved in metaphase II arrest as a cytostatic factor but is neither necessary nor sufficient for initiating oocyte maturation in goldfish.
10439036 1999 Evidence for an important role of serine 16 and its phosphorylation in the stabilization of c-Mos.
10376524 1999 Evidence of an interaction between Mos and Hsp70: a role of the Mos residue serine 3 in mediating Hsp70 association.
9552420 1997 Mos and the cell cycle.
9008413 1997 What does Mos do in oocytes and somatic cells?
9001211 1997 Mos activates myogenic differentiation by promoting heterodimerization of MyoD and E12 proteins.
7540181 1995 Cell cycle genes c-mos and cyclin-B1 are expressed in a specific pattern in human oocytes and preimplantation embryos.
6287464 1982 Human DNA sequence homologous to the transforming gene (mos) of Moloney murine sarcoma virus.
3000766 1985 Human proto-oncogene c-mos maps to 8q11.