Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.28
PubTator Score 0.17

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.9e-08


  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 3.9e-08


Accession Q6PF18 Q86YQ9


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

QFPIPEVKILDPDGVLAEALAMFRKTEEGD                                            211 - 240

Text Mined References (8)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
25248657 Characterization of membrane occupation and recognition nexus repeat containing 3, meiosis expressed gene 1 binding partner, in mouse male germ cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.