Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.61
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 2.100 1.1e-11
diabetes mellitus -1.100 1.9e-03
nasopharyngeal carcinoma -1.600 4.7e-04

Synonym

Accession Q502X0 Q6UL00
Symbols MOPT
BLOCK27

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
19913896 MOPT is associated with dynamic regulation of acrosome biogenesis during late spermiogenesis.

AA Sequence

MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAA      1 - 70
PDLKLKLHM                                                                  71 - 79
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19913896 2010 Identification and characterization of a novel mouse and human MOPT gene containing MORN-motif protein in testis.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.