Property Summary

NCBI Gene PubMed Count 4
PubMed Score 11.15
PubTator Score 52.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.4e-07
Atopic dermatitis 952 4.2e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -1.100 4.2e-02
psoriasis -1.200 9.4e-07

Gene RIF (1)

AA Sequence

MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGR      1 - 70
RSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYL     71 - 140
HVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGF    141 - 210
VKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKA    211 - 280
IHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK                   281 - 335
//

Text Mined References (4)

PMID Year Title