Property Summary

NCBI Gene PubMed Count 4
PubMed Score 10.64
PubTator Score 52.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 4.9e-20
Atopic dermatitis 944 4.2e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -1.100 4.2e-02
psoriasis -3.000 4.9e-20

Gene RIF (1)

PMID Text
18976975 Knockdown of monoacylglycerol O-acyltransferase 1 (MOGAT1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGR      1 - 70
RSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYL     71 - 140
HVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGF    141 - 210
VKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKA    211 - 280
IHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK                   281 - 335
//

Text Mined References (4)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14970677 2003 Genomic organization of the DGAT2/MOGAT gene family in cattle (Bos taurus) and other mammals.
12077311 2002 Identification of a gene encoding MGAT1, a monoacylglycerol acyltransferase.
11481335 2001 Cloning of DGAT2, a second mammalian diacylglycerol acyltransferase, and related family members.