Property Summary

NCBI Gene PubMed Count 20
PubMed Score 21.88
PubTator Score 14.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
progressive supranuclear palsy -1.600 4.5e-02
astrocytic glioma -3.200 4.0e-02
ependymoma -4.400 2.0e-20
glioblastoma -3.700 1.1e-05
oligodendroglioma -2.300 2.7e-07
sonic hedgehog group medulloblastoma -4.400 6.3e-06
atypical teratoid/rhabdoid tumor -4.600 5.3e-10
medulloblastoma, large-cell -4.100 1.5e-04
primitive neuroectodermal tumor -3.800 3.0e-04
active Crohn's disease -1.059 3.0e-02
active ulcerative colitis -1.219 2.4e-02
pediatric high grade glioma -4.100 5.5e-07
pilocytic astrocytoma -4.500 8.5e-09
non primary Sjogren syndrome sicca -1.100 2.0e-02
subependymal giant cell astrocytoma -6.082 1.9e-03
ovarian cancer 1.100 8.8e-10
Down syndrome 1.100 2.5e-02

Gene RIF (6)

PMID Text
26077951 rs1768208 is associated with corticobasal degeneration.
24994843 The rs1768208 risk polymorphism in MOBP has prognostic value in behavioral-variant frontotemporal dementia.
23116876 Genotypes at MOBP and EIF2AK3 confer risk predominantly in APOE epsilon4-positive subjects, with indications of an interaction between APOE and MOBP or EIF2AK3 on Alzheimer's disease risk.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17964117 MOBP mRNA levels were increased in the DLPFC white matter in patients with a history of substance abuse.
15009677 Decreased expression of a number of myelin-related genes, including myelin basic protein (MBP), proteolipid protein (PLP), and myelin-associated oligodendrocyte basic protein (MOBP) was noted in nucleus accumbens of cocaine abusers

AA Sequence

MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRT      1 - 70
SRRAKSPQRPKQQPAAPPAVVRAPAKPRSPPRSERQPRSPPRSERQPRSPPRSERQPRSPPRSERQPRPR     71 - 140
PEVRPPPAKQRPPQKSKQQPRSSPLRGPGASRGGSPVKASRFW                               141 - 183
//

Text Mined References (21)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26077951 2015 Genome-wide association study of corticobasal degeneration identifies risk variants shared with progressive supranuclear palsy.
25416956 2014 A proteome-scale map of the human interactome network.
24994843 2014 Myelin oligodendrocyte basic protein and prognosis in behavioral-variant frontotemporal dementia.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23116876 2013 An exploratory study on STX6, MOBP, MAPT, and EIF2AK3 and late-onset Alzheimer's disease.
21685912 2011 Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17964117 2008 Expression of oligodendrocyte-associated genes in dorsolateral prefrontal cortex of patients with schizophrenia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009677 2004 Gene expression profile of the nucleus accumbens of human cocaine abusers: evidence for dysregulation of myelin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9749786 1998 Cytoskeletal and nuclear localization of myelin oligodendrocytic basic protein isoforms.
7989345 1994 Cloning and expression of myelin-associated oligodendrocytic basic protein. A novel basic protein constituting the central nervous system myelin.