Property Summary

NCBI Gene PubMed Count 27
PubMed Score 90.42
PubTator Score 548.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.200 2.5e-02
pancreatic cancer 1.400 8.3e-03
psoriasis -1.400 1.4e-04
osteosarcoma -1.822 4.5e-03
posterior fossa group B ependymoma 2.400 1.3e-06
atypical teratoid / rhabdoid tumor 1.100 2.8e-02
glioblastoma 1.100 1.0e-04
primitive neuroectodermal tumor 1.600 7.3e-03
Atopic dermatitis -2.200 2.2e-03
non-small cell lung cancer -2.105 3.2e-16
intraductal papillary-mucinous adenoma (... -1.600 1.1e-03
intraductal papillary-mucinous carcinoma... -1.500 2.6e-03
lung cancer -3.300 1.1e-06
colon cancer -2.400 2.4e-06
breast carcinoma -1.600 7.6e-14
interstitial cystitis 3.100 1.0e-04
lung adenocarcinoma -1.900 8.4e-10
pediatric high grade glioma 1.100 1.2e-05
pilocytic astrocytoma 1.600 1.4e-05
pancreatic carcinoma 1.400 8.3e-03
lung carcinoma -2.200 1.6e-08
invasive ductal carcinoma -1.500 4.7e-02

 GO Function (1)

Gene RIF (11)

PMID Text
26446635 Lower levels of anti-elastin are related to CAD [ coronary artery disease ]
25825478 our studies identify MMRN1 expression as a novel biomarker that may refine acute myelogenous leukemia risk stratification.
21058943 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19175495 MMRN1 supported the adhesion of activated, but not resting, washed platelets over a wide range of shear rates
19132231 Multimerin 1 binds factor V and activated factor V with high affinity and inhibits thrombin generation.
18452976 The MMRN1 binding site was located in Factor V.
16363244 MMRN1 is a ligand for alphaIIbbeta3 and alphavbeta3
15849733 Observational study of genotype prevalence. (HuGE Navigator)
15583744 disulfide-linked complexes of multimerin and factor V in platelets could be important for modulating the function of platelet factor V and its delivery onto activated platelets
15452129 multimerin 1 has a role in delivering and localizing factor V onto platelets prior to prothrombinase assembly

AA Sequence

MKGARLFVLLSSLWSGGIGLNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTRVMSAEIATTPE      1 - 70
ARTSEDSLLKSTLPPSETSAPAEGVRNQTLTSTEKAEGVVKLQNLTLPTNASIKFNPGAESVVLSNSTLK     71 - 140
FLQSFARKSNEQATSLNTVGGTGGIGGVGGTGGVGNRAPRETYLSRGDSSSSQRTDYQKSNFETTRGKNW    141 - 210
CAYVHTRLSPTVILDNQVTYVPGGKGPCGWTGGSCPQRSQKISNPVYRMQHKIVTSLDWRCCPGYSGPKC    211 - 280
QLRAQEQQSLIHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVN    281 - 350
DVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDIVREQFKIFQNDMQETVAQLFKTVSSLSEDL    351 - 420
ESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTCEKPIKELEVKQTHLEG    421 - 490
ALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMM    491 - 560
LQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDN    561 - 630
KMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHN    631 - 700
LLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDME    701 - 770
TILTFIPQFHRLNDSIQTLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQN    771 - 840
MSHLEEKLLLTTKISKNFETRLQDIESKVTQTLIPYYISVKKGSVVTNERDQALQLQVLNSRFKALEAKS    841 - 910
IHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIPKWIKHSLPDIQLLQKGLTEFVEPIIQIKTQAALS    911 - 980
NLTCCIDRSLPGSLANVVKSQKQVKSLPKKINALKKPTVNLTTVLIGRTQRNTDNIIYPEEYSSCSRHPC    981 - 1050
QNGGTCINGRTSFTCACRHPFTGDNCTIKLVEENALAPDFSKGSYRYAPMVAFFASHTYGMTIPGPILFN   1051 - 1120
NLDVNYGASYTPRTGKFRIPYLGVYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTGD   1121 - 1190
ALLELNYGQEVWLRLAKGTIPAKFPPVTTFSGYLLYRT                                   1191 - 1228
//

Text Mined References (32)

PMID Year Title
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26446635 2015 Circulating Anti-Elastin Antibody Levels and Arterial Disease Characteristics: Associations with Arterial Stiffness and Atherosclerosis.
25825478 2015 Multimerin-1 (MMRN1) as Novel Adverse Marker in Pediatric Acute Myeloid Leukemia: A Report from the Children's Oncology Group.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
21058943 2011 Replication of GWAS associations for GAK and MAPT in Parkinson's disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19175495 2009 Platelet adhesion to multimerin 1 in vitro: influences of platelet membrane receptors, von Willebrand factor and shear.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19132231 2008 Multimerin 1 binds factor V and activated factor V with high affinity and inhibits thrombin generation.
18452976 2008 Location of the multimerin 1 binding site in coagulation factor V: an update.
16363244 2005 Analyses of cellular multimerin 1 receptors: in vitro evidence of binding mediated by alphaIIbbeta3 and alphavbeta3.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
15849733 2005 Spectrum and frequencies of mutations in MSH2 and MLH1 identified in 1,721 German families suspected of hereditary nonpolyposis colorectal cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15583744 2004 Human platelets contain forms of factor V in disulfide-linkage with multimerin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15452129 2004 Identification of the MMRN1 binding region within the C2 domain of human factor V.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10828608 2000 The human multimerin gene MMRN maps to chromosome 4q22.
10613677 1999 Platelet multimerin and its proteolytic processing.
9798985 1998 Platelet glycoprotein Ia* is the processed form of multimerin--isolation and determination of N-terminal sequences of stored and released forms.
9454761 1998 Studies of multimerin in human endothelial cells.
9372017 1995 Multimerin.
9189649 1997 Multimerin: a bench-to-bedside chronology of a unique platelet and endothelial cell protein--from discovery to function to abnormalities in disease.
8652809 1996 An autosomal dominant, qualitative platelet disorder associated with multimerin deficiency, abnormalities in platelet factor V, thrombospondin, von Willebrand factor, and fibrinogen and an epinephrine aggregation defect.
8514871 1993 Multimerin is found in the alpha-granules of resting platelets and is synthesized by a megakaryocytic cell line.
7629143 1995 The cDNA sequence of human endothelial cell multimerin. A unique protein with RGDS, coiled-coil, and epidermal growth factor-like domains and a carboxyl terminus similar to the globular domain of complement C1q and collagens type VIII and X.