Property Summary

Ligand Count 1,345
NCBI Gene PubMed Count 647
PubMed Score 1799.18
PubTator Score 1264.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Atherosclerosis 291 3.811 1.9

Expression

  Differential Expression (11)

Disease log2 FC p
periodontitis 1.100 1.9e-07
colon cancer 1.500 2.8e-02
cystic fibrosis 3.549 2.2e-05
ductal carcinoma in situ 3.000 3.3e-04
fibroadenoma 1.400 2.8e-02
inflammatory breast cancer 1.600 2.9e-02
interstitial cystitis 6.500 8.3e-05
nasopharyngeal carcinoma 1.700 1.1e-02
non-small cell lung cancer 2.195 1.8e-08
psoriasis 1.100 7.5e-06
ulcerative colitis 6.800 3.7e-08

Protein-protein Interaction (7)

PDB (41)

Gene RIF (685)

AA Sequence

MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKF      1 - 70
LGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKV     71 - 140
WEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGT    141 - 210
NLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPV    211 - 280
PPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKD    281 - 350
LVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP    351 - 420
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC                 421 - 477
//

Text Mined References (648)

PMID Year Title