Property Summary

NCBI Gene PubMed Count 52
PubMed Score 51.91
PubTator Score 66.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0
Malaria 140 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.086 1.5

Gene RIF (41)

PMID Text
26279442 MMP26+CXCR4+ cells may be circulating tumor cells in hepatocellular carcinoma.
25566961 We found that only inhibition of JNK significantly decreased the activation of MMP26 in response to FGF1 stimulation, suggesting that activation of FGFR1 signaling may activate JNK to activate MMP26 in non-small-cell lung cancer
25262277 Overexpression of MMP26 in SW1353 cells increased cell invasiveness, while inhibition of MMP26 decreased cell invasiveness.
25093616 The binding of MMP-26 to GDF15 was responsible for the processing and maturation of pro-GDF15, and the process was dependent on enzymatic activity of MMP-26. In human placental trophoblast cells, MMP-26 could facilitate the pro-apoptotic effect of GDF15.
25091573 High MMP26 expression is associated with metastasis of hepatocellular carcinoma.
24565841 These results demonstrate that the HOXA10-mediated expression of MMP-26 promotes embryo adhesion during the process of embryonic implantation.
24318970 matrilysin-2 was an independent prognostic marker for patients with colorectal cancer
23754174 The MMP-26 promoter region contains a putative ER response element.
23634280 expression of MMP-26 protein was predominantly located in pre- and early-invasive areas suggesting MMP-26 expression as an early event in promoting GM-CSF dependent tumor invasion.
21945733 Molecular analyses showed significant downregulation of expression of MMP-26 (p=0.03), and significant 9.8-fold upregulation of TGF-beta (p=0.01) in more degenerated discs vs. healthier discs.
21805034 MMP-26 plays an important role in local invasion at least in part through coordination with MMP-9.
21255765 direct association observed between morphological scores of malignancy and MMP immunoreactivity, with the association being significant for MMP-26. present results demonstrate important role of MMPs in development of SCCs of lower lip and tongue.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20491537 role of these proteins in the process of invasion and metastasis cannot be ruled out since their presence is more marked along the tumor invasion front compared to more central areas of squamous cell carcinoma of the tongue
20230842 Observational study of gene-disease association. (HuGE Navigator)
20074375 GnRH I and II could up-regulate MMP-26 expression through the JNK signaling pathway in human trophoblast-like/trophoblast cells.
19956866 MMP-26 contributes to tumor cell invasion, migration and angiogenesis
19921252 MMP-26 expression in stroma is associated with larger Merkel cell carcinoma with poor prognosis.
19895737 MMP-26 expression may be associated with multiple human carcinomas. MMP-26 may also contribute to smooth muscle function in the human prostate and cardiovascular system.
19674198 MMP-26 and MMP-9 may contribute to the more aggressive behavior of squamous cell carcinomas in organ transplant recipients
19448419 MMP-26 may be served as a tumor marker in monitoring progression and predicting prognosis of non-small cell lung cancer.
19336475 Observational study of gene-disease association. (HuGE Navigator)
18765015 expression of transmembrane 4 superfamily member 4 (TM4SF4) and matrix metalloproteinase 26 (MMP26) was found to be significantly decreased during the implantation window in patients with polycystic ovary syndrome.
18210030 Observational study of gene-disease association. (HuGE Navigator)
17873896 The putative role of MMP-26 as a marker of metastasesin pancreatic cancer warrants further studies
17176253 A human breast cancer cell linetransfected with wild-type MMP-26 cDNA showed a calcium-dependent invasive potential when compared with controls.
16984259 results suggest that MMP-21 and MMP-26 are not only associated with cancer but may be important in connective tissue remodelling and pathobiology of various benign skin disorde
16940965 Results indicate that MMP-26 and TIMP-4 may play an integral role during the conversion of high-grade prostatic intraepithelial neoplasia to invasive cancer and may also serve as markers for early prostate cancer diagnosis.
16809379 Maximal expression of MMP-26, in the early and mid-secretory phase suggests its role during implantation and results show it is stored in epithelial cells, is not released spontaneously, and is controlled by TIMP-4 in both stroma and uterine fluid.
16641547 During esophageal tumorigenesis, MMP-21 and MMP-26 have different, unique expression patterns.
15601912 The expression patterns of MMP26 in human placenta suggests complicated roles for MMP26 during the processes of placentation and hematopoiesis
15333466 Matrilysin-2 overexpression is associated with tumor progression and activation of MMP-9 in esophageal squamous cell carcinoma
15273280 Results suggest a functional relationship between TIMP-4 mRNA and MMP-26 mRNA, and possibly a role in human implantation.
14744773 MMP-26 was colocalized with MMP-9, TIMP-2, and TIMP-4 in breast cancer cells.
14532275 distinguish shallow, intermediate, and deep S1' pocket characteristics
12969699 Present throughout menstrual cycle. Elevated during early to mid-luteal phase. Elevations in users of levonorgestrel implants experiencing irregular uterine bleeding. Seems to play role in hormonal regulation and endometrial tissue remodeling.
12586837 Details of cleavage of pro-MMP-9 by MMP-26, facilitating the efficient cleavage of fibronectin by MMP-9, and promoting invasiveness of ARCaP cells across fibronectin or type IV collagen
12119297 substrate specificity and protein cleavage sites
11931652 Promoter characterization of the novel human matrix metalloproteinase-26 gene: regulation by the T-cell factor-4 implies specific expression of the gene in cancer cells of epithelial origin.
11889136 role of histidine(81) in mechanism of activation
11841844 can cleave all subclasses of igG at a specific conserved site

AA Sequence

MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLD      1 - 70
MQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQ     71 - 140
QVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEI    141 - 210
GHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP                       211 - 261
//

Text Mined References (52)

PMID Year Title
27143441 2016 MiR-125b regulates endometrial receptivity by targeting MMP26 in women undergoing IVF-ET with elevated progesterone on HCG priming day.
26279442 2015 Circulating Hepatocellular Carcinoma Cells are Characterized by CXCR4 and MMP26.
25566961 2015 Activation of FGF receptor signaling promotes invasion of non-small-cell lung cancer.
25262277 2015 Regulation of chondrosarcoma invasion by MMP26.
25093616 2014 Maturation of growth differentiation factor 15 in human placental trophoblast cells depends on the interaction with Matrix Metalloproteinase-26.
25091573 2014 Inhibition of fibroblast growth factor receptor signaling impairs metastasis of hepatocellular carcinoma.
24565841 2014 Activation of matrix metalloproteinase-26 by HOXA10 promotes embryo adhesion in vitro.
24318970 2014 Matrilysin-2 expression in colorectal cancer is associated with overall survival of patients.
23754174 2013 Estrogen and estrogen receptor induce matrix metalloproteinase-26 expression in endometrial carcinoma cells.
23634280 2013 GM-CSF enhances tumor invasion by elevated MMP-2, -9, and -26 expression.
23569462 2013 The Anti-inflammatory Role of Endometase/Matrilysin-2 in Human Prostate Cancer Cells.
21945733 2012 Matrix metalloproteinase-26, a novel MMP, is constitutively expressed in the human intervertebral disc in vivo and in vitro.
21805034 Non-small cell lung cancer invasion and metastasis promoted by MMP-26.
21255765 2011 Immunohistochemical expression of matrix metalloproteinases in squamous cell carcinoma of the tongue and lower lip.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20491537 2010 Matrilysins may not predict the metastatic potential in squamous cell carcinoma of the tongue.
20230842 2010 Association between polymorphisms of matrix metalloproteinase 11 (MMP-11) and Kawasaki disease in the Korean population.
20074375 2010 GnRH I and II up-regulate MMP-26 expression through the JNK pathway in human cytotrophoblasts.
19956866 2010 Expression of Matrix Metalloproteinase-26 promotes human glioma U251 cell invasion in vitro and in vivo.
19921252 2009 Expression of MMP-10, MMP-21, MMP-26, and MMP-28 in Merkel cell carcinoma.
19895737 2009 Expression of matrix metalloproteinase-26 in multiple human cancer tissues and smooth muscle cells.
19674198 2009 Matrix metalloproteinase-26 is present more frequently in squamous cell carcinomas of immunosuppressed compared with immunocompetent patients.
19448419 2009 Expression and clinical significance of matrix metalloproteinase (MMP)-26 protein in non-small cell lung cancer.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
18765015 2008 Microarray evaluation of endometrial receptivity in Chinese women with polycystic ovary syndrome.
18210030 2008 Analysis of novel risk loci for type 2 diabetes in a general French population: the D.E.S.I.R. study.
17873896 2007 Increased expression of matrix metalloproteinases-21 and -26 and TIMP-4 in pancreatic adenocarcinoma.
17176253 2007 Calcium regulates tertiary structure and enzymatic activity of human endometase/matrilysin-2 and its role in promoting human breast cancer cell invasion.
16984259 2006 MMP-21 is expressed by macrophages and fibroblasts in vivo and in culture.
16940965 2006 Coordinated peak expression of MMP-26 and TIMP-4 in preinvasive human prostate tumor.
16809379 2006 Endometrial TIMP-4 mRNA is expressed in the stroma, while TIMP-4 protein accumulates in the epithelium and is released to the uterine fluid.
16641547 2006 Matrix metalloproteinases 21 and 26 are differentially expressed in esophageal squamous cell cancer.
15816845 2005 Matrilysin-2 (matrix metalloproteinase-26) is upregulated in keratinocytes during wound repair and early skin carcinogenesis.
15625428 2005 Matrilysins-1 and -2 (MMP-7 and -26) and metalloelastase (MMP-12), unlike MMP-19, are up-regulated in necrotizing enterocolitis.
15601912 2005 Spatio-temporal expression of matrix metalloproteinase-26 in human placental trophoblasts and fetal red cells during normal placentation.
15574774 2004 Matrix metalloproteinase-26 is associated with estrogen-dependent malignancies and targets alpha1-antitrypsin serpin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15350356 2004 Matrix metalloproteinase-26 (matrilysin-2) expression is high in endometrial hyperplasia and decreases with loss of histological differentiation in endometrial cancer.
15333466 2004 Association of matrilysin-2 (MMP-26) expression with tumor progression and activation of MMP-9 in esophageal squamous cell carcinoma.
15273280 2004 Endometrial TIMP-4 mRNA is high at midcycle and in hyperplasia, but down-regulated in malignant tumours. Coordinated expression with MMP-26.
14744773 2004 Endometase/matrilysin-2 in human breast ductal carcinoma in situ and its inhibition by tissue inhibitors of metalloproteinases-2 and -4: a putative role in the initiation of breast cancer invasion.
14532275 2003 The intermediate S1' pocket of the endometase/matrilysin-2 active site revealed by enzyme inhibition kinetic studies, protein sequence analyses, and homology modeling.
12969699 2003 Expression of matrix metalloproteinase-26 and tissue inhibitor of matrix metalloproteinase-3 and -4 in endometrium throughout the normal menstrual cycle and alteration in users of levonorgestrel implants who experience irregular uterine bleeding.
12586837 2003 Activation of pro-gelatinase B by endometase/matrilysin-2 promotes invasion of human prostate cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119297 2002 Peptide substrate specificities and protein cleavage sites of human endometase/matrilysin-2/matrix metalloproteinase-26.
11931652 2002 Promoter characterization of the novel human matrix metalloproteinase-26 gene: regulation by the T-cell factor-4 implies specific expression of the gene in cancer cells of epithelial origin.
11389678 2001 Characterization of matrix metalloproteinase-26, a novel metalloproteinase widely expressed in cancer cells of epithelial origin.
10987280 2000 Matrilysin-2, a new matrix metalloproteinase expressed in human tumors and showing the minimal domain organization required for secretion, latency, and activity.
10824119 2000 Cloning of MMP-26. A novel matrilysin-like proteinase.
10801841 2000 Identification and characterization of human endometase (Matrix metalloproteinase-26) from endometrial tumor.
10419448 1999 Matrix metalloproteinases.