Property Summary

NCBI Gene PubMed Count 1,421
PubMed Score 5840.04
PubTator Score 4473.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 1.45209307025471E-16
Duchenne muscular dystrophy 602 1.10774009641739E-9
cystic fibrosis 1670 6.32349996063863E-9
malignant mesothelioma 3163 1.19618914762882E-8
atypical teratoid / rhabdoid tumor 4369 1.67346239163079E-6
ovarian cancer 8492 1.91324502579138E-6
adrenocortical carcinoma 1427 1.11391567251543E-5
pilocytic astrocytoma 3086 9.45711789696205E-5
sonic hedgehog group medulloblastoma 1482 1.59936760345272E-4
psoriasis 6685 3.96190021872036E-4
lung cancer 4473 4.74698117255297E-4
pancreatic cancer 2300 6.62288669416823E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.54655713418954E-4
Becker muscular dystrophy 187 8.21026077147212E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.97399476256061E-4
ulcerative colitis 2087 0.0011474621454021
adult high grade glioma 2148 0.00194764250926309
Atopic dermatitis 944 0.00205460598675611
primary pancreatic ductal adenocarcinoma 1271 0.00249944803152049
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00816396024184626
primitive neuroectodermal tumor 3031 0.00833484975165058
oligodendroglioma 2849 0.010206534750764
subependymal giant cell astrocytoma 2287 0.0106825008504384
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0110869323625155
astrocytic glioma 2241 0.0118325544963888
adrenocortical adenoma 134 0.026559628638455
interstitial lung disease 292 0.0268513941229522
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 1.0

Expression

See source...

Synonym

Accession P08253 B2R6U1 B4DWH3 E9PE45 Q9UCJ8
Symbols CLG4
MONA
CLG4A
MMP-2
TBE-1
MMP-II

Gene

PDB

1CK7   1CXW   1EAK   1GEN   1GXD   1HOV   1J7M   1KS0   1QIB   1RTG   3AYU  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
2067 screening 9 / 0 / 0 Late stage results from the probe development efforts to identify inhibitors of Matrix Metalloproteinase-13 (MMP-13).
602330 screening 85 / 0 / 1842 Single concentration validation of uHTS RPN11 inhibitor hits using a MMP-2 Fluorescence assay
602361 confirmatory 92 / 0 / 304 Dose Response validation of uHTS RPN11 inhibitor hits using a MMP-2 Fluorescence assay
686932 confirmatory 15 / 0 / 35 SAR validation of uHTS RPN11 inhibitor hits using a MMP-2 Fluorescence assay

Gene RIF (1412)

PMID Text
27273943 Overexpression of MMP2 and EGFR were independent risk factors for mortality in non-small cell lung cancer patients.
27078876 Data show that spider venom sphingomyelinase D increased expression/secretion of MMP2, MMP9 and MMP7 which was associated with keratinocyte cell death.
27038607 Independent prognostic value of MMP-2 expression in ovarian cancer is limited to a role in PFS for epithelial MMP-2 expression.
26978416 MMP2 variants are associated with rheumatoid arthritis in women.
26978018 The morphologically normal tissue adjacent to the tumor shows the substantial expression of MMP-2 and MMP-9 and in some cases the enhanced activity of uPA and ACE, which makes an additional contribution to the increased invasive potential of tumor
26973196 determined normal concentration ranges for MMP-1, MMP-2, MMP-9, TIMP-1, and ratios of concentrations of MMPs and TIMP-1 (MMP-1/TIMP-1, MMP-2/TIMP-1, MMP-9/TIMP-1) in the amniotic fluid at the first period of labor in physiological pregnancy.
26872030 TIMP3 was validated as a direct target of miRNA-21 by dual-luciferase reporter assay. Silencing with small interfering RNA against TIMP3 promoted angiogenesis and increased MMP2 and MMP9 expression at the protein level.
26860011 renal cell carcinoma patients with a high MMP-2 expression level exhibit rapid progression of renal cell carcinoma and that high MMP-2 expression level is associated with poor prognosis
26823829 The expression of MMP-2 was associated with pulmonary metastasis, and was related to the prognosis of osteosarcoma.
26814712 Cox analysis of MMP-2 and -9 were significant independent predictors of disease-free survival in colorectal carcinoma.
More...

AA Sequence

MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVL      1 - 70
KDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETV     71 - 140
DDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDD    141 - 210
ELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALF    211 - 280
TMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCV    281 - 350
FPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL    351 - 420
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKD    421 - 490
RFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLG    491 - 560
LPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSY    561 - 630
FFKGAYYLKLENQSLKSVKFGSIKSDWLGC                                            631 - 660
//

Text Mined References (1439)

PMID Year Title
27273943 Prognostic significance of overexpressed matrix metalloproteinase-2, mouse-double minute: 2 homolog and epidermal growth factor receptor in non-small cell lung cancer.
27078876 2016 Sphingomyelinase D from Loxosceles laeta Venom Induces the Expression of MMP7 in Human Keratinocytes: Contribution to Dermonecrosis.
27038607 2016 Limited independent prognostic value of MMP-14 and MMP-2 expression in ovarian cancer.
26978416 2015 [Matrix metalloproteinase 2, 3, and 9 gene polymorphisms in women with rheumatoid arthritis].
26978018 [Matrix metalloproteinases 2 and 9, their endogenous regulators, and angiotensin-converting enzyme in cervical squamous cell carcinoma].
26973196 [Reference ranges of matrix metalloproteinase-1, -2, -9 and tissue inhibitor of matrix metalloproteinases-1 concentrations in amniotic fluid in physiological pregnancy].
26872030 2016 The Angiogenic Effect of microRNA-21 Targeting TIMP3 through the Regulation of MMP2 and MMP9.
26860011 2015 Clinicopathological Significance of Matrix Metalloproteinase-2 Protein Expression in Renal Cell Carcinoma Patients.
26823829 2015 Association of MMP-2 expression and prognosis in osteosarcoma patients.
26814712 2016 High expression of matrix metalloproteinases: MMP-2 and MMP-9 predicts poor survival outcome in colorectal carcinoma.
More...