Property Summary

NCBI Gene PubMed Count 259
PubMed Score 1132.95
PubTator Score 649.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 4.6e-02
periodontitis 1.100 4.0e-10
non-small cell lung cancer 1.825 1.9e-07
colon cancer 1.100 4.1e-02
lung adenocarcinoma 1.700 4.6e-06
invasive ductal carcinoma 1.222 3.3e-02
Breast cancer 1.500 5.4e-05
head and neck cancer 1.300 2.1e-02
head and neck cancer and chronic obstruc... 1.300 1.2e-02

 CSPA Cell Line (3)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
570 screening 46 / 0 / 64879 Primary biochemical high-throughput screening assay for inhibitors of Matrix Metalloproteinase 13 (MMP13) activity
734 screening 8 / 0 / 5141 Assay to identify inhibitors among the possible fluorescent artifacts from the primary HTS inhibition assay of Matrix Metalloproteinase 13 (MMP13) activity
735 confirmatory 15 / 0 / 27 Dose-response biochemical assay for inhibitors of Matrix Metalloproteinase 13 (MMP13) activity
769 confirmatory 4 / 0 / 4 Dose response biochemical assay for autofluorescent inhibitors of Matrix Metalloproteinase 13 (MMP13) activity
1931 summary 2 / 0 / 0 Summary of probe development efforts to identify inhibitors of Matrix Metalloproteinase-13 (MMP-13)
2067 screening 9 / 0 / 0 Late stage results from the probe development efforts to identify inhibitors of Matrix Metalloproteinase-13 (MMP-13).

Gene RIF (242)

PMID Text
26934732 Hyaluronic acid exhibits a pronounced suppressive effect on MMP-13 expression in osteoarthritis.
26474296 IL-1Ra is associated with MMP-13 expression and has a novel function in such regulation without interference of the IL-1 signaling cascade.
26447617 Report modified platelet deposition on matrix metalloproteinase 13 digested collagen I
26395178 Data show that the expression of transforming growth factor beta 1 (TGFB1) was correlated with the expression of SMA- and MAD-related protein 3 (SMAD3) and matrix metalloproteinase-13 (MMP13) in osteoarthritis (OA)-affected cartilage.
26378022 GP73 enhances MMP-13 expression through cAMP responsive element binding protein (CREB)-mediated transcription activation. Levels of GP73 and MMP-13 are increased and positively correlated in human HCC tissues. Augmented MMP-13 potentiates HCC cell metastasis.
26369384 SENP2 inhibits MMP13 expression in BC cells through de-SUMOylation of TBL1/TBLR1, which inhibits nuclear translocation of beta-catenin.
26362844 siRNA inhibited the effect of MMP13-containing exosomes on tumor cells metastasis as well as angiogenesis
26308852 RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13
26305549 Data show that blocking the interleukin-8 (IL-8)/androgen receptor (AR)/matrix metalloproteinases (MMPs) signals partially reversed the infiltrating B cells capacity to increase the bladder cancer (BCa) cell invasion.
26305372 together, these data demonstrate that SERPINE2 might prevent cartilage catabolism by inhibiting the expression of MMP-13, one of the most relevant collagenases, involved in cartilage breakdown in OA.
26104765 Together, these data suggest that shikonin may suppress Osteosarcoma invasiveness through MMP13 suppression. Thus, our data highlight a previous unappreciated role for shikonin in suppressing Osteosarcoma cell metastasis
26092928 Data show that knockdown of endogenous periostin attenuates constitutive matrix metalloproteinase-13 (MMP-13) expression.
25976617 our results revealed that activation of the P2X7 receptor by ATP promotes breast cancer cell invasion and migration, possibly via activation of the AKT pathway and regulation of E-cadherin and MMP-13 expression.
25966777 Both VEGF-C and MMP13 are significantly upregulated in Multiple Myeloma with lymph-node metastases.
25948792 High expression of matrix metalloproteinase-13 is associated with pancreatic cancer.
25880591 This study demonstrates that stromal as well as tumor derived MMP13 contribute to tumor cell extravasation and establishment of metastases in the liver microenvironment.
25863779 MMP-13 can be useful to confirm the diagnosis of alcoholic liver cirrhosis, but levels of MMP-1 are not significantly increased in patients with liver cirrhosis compared to controls.
25846944 IL-32 stimulation promotes the invasion and motility of osteosarcoma cells, possibly via the activation of AKT and the upregulation of MMP-13 expression.
25835975 Together, these data suggest that GRh2 may suppress GBM migration through inhibiting Akt-mediated MMP13 activation.
25772251 Expression levels of miR-125b were negatively correlated with metastatic potential of NSCLC tumors, which may function through regulation of MMP-13.
25749207 MMP-13 was associated with metastasis and poor survival in 79 patients with melanoma. MMP-13 expression was inversely correlated with vasculogenic mimicry. MMP-13 cleaves laminin-5 gamma 2 to accelerate metastasis.
25742789 Up-regulation of matrix metalloproteinase 13 is associated with colitis-associated cancer.
25609201 Clusterin is an independent predictive factor for prognosis of hepatocellular carcinoma and it facilitates metastasis through EIF3I/Akt/MMP13 signaling.
25607396 The expression of MMP-7, -8, -9 and -13 in the gingiva of the young patients with aggressive periodontitis and type 1 diabetes mellitus was positive in all studied cases.
25562781 During the Barrett's pathogenesis process, MMP activity is increased early on in the inflamed esophagus and remains high in metaplasia and esophageal adenocarcinoma. However, there is a switch of MMP13 to MMP9 expression once neoplasia develops.
25527274 Pit-1 regulates MMP-1 and MMP-13, and that inhibition of MMP-13 blocked invasiveness to lung in Pit-1-overexpressed breast cancer cells.
25401159 High level of protein expression of MMP13 was significantly associated with poor prognosis in oral squamous cell carcinoma.
25166220 MMP-13 overexpression or exogenous MMP-13 reduces anoikis by more effectively shedding NG2.
25006778 Elevated levels of MMP-13 may play a role in the pathogenesis of chronic periodontitis. There is a direct correlation of increased expression of MMP-13 with various clinical and histologic parameters in disease severity
24974940 Collagenase-3 may play a role in the conversion of a periapical granuloma with epithelium to radicular cyst
24781753 Nonsense mutation in exon 2 of MMP13 was described in two brothers who presented with short stature and mixed epiphyseal and metaphyseal dysplasia.
24704999 These in vivo findings suggest a role for metalloproteinase-13 in the development and progression of adult human dental tissue disorders.
24648384 MMP13 mutations are the cause of recessive metaphyseal dysplasia, Spahr type.
24615104 The results showed that MMP7-181A/G and MMP13-77A/G variants were associated with Colorectal cancer
24613731 IL-1beta-induced MMP-13 expression and changes in cell proliferation and apoptosis in alpha7(+)hSMSC-OB cells are regulated by ADAM-28.
24610617 Suggest elevated level of preoperative MMP-13 was found to associate with tumor progression and poor survival in patients with esophageal squamous cell carcinoma.
24599080 Data indicate that osthole-directed migration activity involves down-regulation of matrix metalloproteinase (MMP)-13 and cell motility dependent focal adhesion kinase (FAK) in migration-prone glioma cells.
24563279 In colorectal adenoma-carcinoma sequence, MMP- 13 overexpression occurred early in the adenoma stage and persisted after malignant transformation.
24398989 All these data proved the utility of CXCR4, MMP-13 and beta-catenin immunohistochemical investigation in basal cell carcinoma.
24360951 miR-126-5p was significantly downregulated in stromal cells of Giant cell tumor and affect osteoclast (OC) differentiation and bone resorption by repressing MMP-13 expression at the post-transcriptional level.
24351915 genotype distribution of MMP13 differed significantly between the group with unilateral tooth agenesis and the controls
24180431 activity in chondrocytes reduced by moderate fluid flow shear stress
24023851 presence of MMP-13 seems to limit the overall extent of ECM deposition in lung fibrosis
24008762 MMP13 expression alone is sufficient to overcome the SENP2-induced inhibition of cell migration and invasion.
23913860 Crystal structure of peptide-MMP-13 interactions have led authors to propose how triple helical collagen strands fit into the active site cleft of the collagenase.
23898086 The present study evaluated the association between these single nucleotide polymorphisms in MMP12 and MMp13 in patients with colorectal cancer (CRC) patients and healthy controls.
23847446 provide the first evidence to demonstrate that 1,25-(OH)2D3 activates MMP13 expression through p38 pathway in chondrocytes
23762330 This is the first report elucidating a feedback regulation between miR-127 and the TGFbeta/c-Jun cascade in hepatocellular carcinoma migration via MMP13.
23732700 MicroRNA-143 inhibits cell migration and invasion by targeting matrix metalloproteinase 13 in prostate cancer.
23665089 Nonmucinous carcinomas showed higher MMP-13 expression compared with mucinous carcinomas.
23467939 MMP-13 is associated with thyroid tumour invasion and metastasis.
23465389 Decreases in the MMP-2 (-735) polymorphism GG genotype and increases in the MMP-13 (A77G) polymorphism AG and GG genotypes increase the risk for lung cancer.
23417678 methylation of different CpG sites in the proximal promoters of the human MMP13 and IL1B genes modulates their transcription by distinct mechanisms
23334990 Our data add to the understanding of MMP13 regulation, which is essential before such mechanisms can be exploited to alleviate the cartilage destruction associated with osteoarthritis.
23162804 The present results suggest that the S100A4 gene may control the invasive potential of human breast cancer cells by modulating MMP-13 levels, thus regulating metastasis and angiogenesis in breast tumors.
23132541 Report elevated expression of MMP-13 in osteroarthritic cartilage.
22992737 MMP-13 may directly and indirectly promote tumor angiogenesis
22950625 MMP-13 was correlated with progression and metastasis of colorectal cancer.
22869368 Osterix regulates calcification and degradation of chondrogenic matrices through matrix metalloproteinase 13 (MMP13) expression in association with transcription factor Runx2 during endochondral ossification
22782903 a novel molecular mechanism by which MMP13 is up-regulated in cSCCs and indicate that miR-125b plays a tumor suppressive role in cSCC.
22722466 MMP-13 is expressed by tumor epithelial cells, stromal and inflammatory cells of nonmelanoma skin cancer in xeroderma pigmentosum and non-xeroderma pigmentosum.
22710868 T allele of MMP-13 intron polymorphism rs640198 is associated with the severity of coronary artery disease.
22710194 Genetic variations in MMP13 may contribute to individual differences in caries susceptibility. Our findings reinforce that susceptibility to caries results from gene-environment interactions.
22610965 demonstrate that beta-adrenergic receptor stimulation leads to MMP-13 transactivation of protease-activated receptor 1 in both cardiac fibroblasts and cardiomyocytes
22590832 Data show that angiotensin II through activation of AT1 receptors can stimulate the expression of MMP-2, MMP-13 and VEGF, but not MMP-13, in B16F10 melanoma cells.
22573319 The minimum collagen type III sequence necessary for cleavage by MMP1 and MMP13 was 5 GXY triplets, including 4 residues before and 11 residues after the cleavage site (P4-P11').
22505473 identified CREB as the regulating factor able to only bind to the MMP13 promoter when the -104 CpG is demethylated
22488635 expression by tumor cells associated with poor prognosis in colorectal cancer
22327326 Increased expression of MMP-13 and MT1-MMP in the tumor portion of hyperostosis of meningiomas might contribute to the initiation of osteolysis.
22273691 Expression of miRNA-140 and MMP-13 was induced by IL-1beta
22270366 ETS-1 protein regulates vascular endothelial growth factor-induced matrix metalloproteinase-9 and matrix metalloproteinase-13 expression in human ovarian carcinoma
22158614 a novel role for ELF3 as a procatabolic factor that may contribute to cartilage remodeling and degradation by regulating MMP13 gene transcription.
22153941 analysis of non-zinc binding inhibitors of MMP13
22128168 Wnt5a-Ror2 signaling might also be required for expression of MMP-13 gene during the development of the cartilaginous tissue.
22102411 a conserved region at 20 kb upstream from the MMP-13 TSS includes a distal transcriptional response element of MMP-13, which contributes to MMP-13 gene expression.
22095691 findings show that C/EBPbeta and RUNX2, with MMP-13 as the target and HIF-2alpha as the inducer, control cartilage degradation
22084953 Nuclear expression of MMP-13, but not cytoplasmic expression of MMP-2, -8, and -9, was associated with invasion depth and tumor size. Furthermore, high nuclear MMP-13 expression was predictive of poor outcome
22032644 within the inflammatory bone microenvironment MMP-13 production was up-regulated in breast tumour cells leading to increased pre-osteoclast differentiation and their subsequent activation
22006368 The results suggest that the main proteolytic cascade, MMP-2/MMP-13/MT1-MMP is involved in osteoblast differentiation through mechanical forces.
21959927 ET-1 activated FAK/PI3K/AKT/mTOR, which in turn activated IKK and NF-kappaB, resulting in increased MMP-13 expression and migration in human chondrosarcoma cells.
21938739 Oct-3/4 enhanced degradation of surrounding extracellular matrix by increasing MMP-13 expression and altering integrin signaling
21913037 MMP-9 and uPA might be involved in the activation of pro-MMP-13 through unknown mechanisms in arthritic diseases.
21881840 MMP-9, MMP-13 and TIMP-1 expression may serve as a prognostic marker for early tumor invasiveness. Moreover, up-regulation of TIMP-1 in tumor and/or surrounding stromal cells may indicate an increased risk for BCC recurrence.
21849805 Forced MMP-13 expression effectively accelerated recovery from liver cirrhosis
21720458 Short-term, high-dose rosuvastatin therapy has no effect on matrix metalloproteinase-13 and tissue inhibitor of metalloproteinase-1 levels in hypercholesterolemic patients.
21539914 MMP-1 and MMP-13 differential regulation of osteoblastic markers in MG63 cells likely results from their modulation of divergent signaling pathways involved in osteoblastic differentiation
21508380 Induction of MMP-13 expression is associated with bone-metastasizing breast cancer.
21437966 Autologous protein solution inhibits MMP-13 production by IL-1beta and TNFalpha-stimulated human articular chondrocytes.
21344384 15-deoxy-Delta(12,14)-prostaglandin-J2 and ciglitazone attenuated TNF-alpha-induced MMP-13 expression in synovial fibroblasts primarily through the modulation of NF-kappaB signaling pathways.
21344378 CCN3 enhances the migration of chondrosarcoma cells by increasing MMP-13 expression through the alphavbeta3/alphavbeta5 integrin receptor, FAK, PI3K, Akt, p65, and NF-kappaB signal transduction pathway.
21339746 findings indicate that MUC1 contributes to ESCC metastasis by stimulating MMP13 expression, suggesting MUC1 as a novel diagnostic biomarker and therapeutic target in ESCC
21278254 IL-6 and IL-6 receptor interaction enhances migration of chondrosarcoma through an increase in MMP-13 production.
21211511 the implication of H-Ras and NADPH oxidase-generated superoxide production in MMP-13 gene regulation by IL-1beta and TNF-alpha
21205837 These results strongly suggest the underlying mechanism of CXCR4 promoting Tca8113 migration and invasion by regulating MMP-9 and MMP-13 expression perhaps via activation of the ERK signaling pathway.
21191416 Expression of matrix metalloproteinase-13 is controlled by IL-13 via PI3K/Akt3 and PKC-delta in normal human dermal fibroblasts.
21187486 Cells expressed PTHrP and that this factor stimulated MMP-13 expression, metastatic bone destruction may result from a PTHrP autocrine loop involving a PKC-ERK1/2 signaling pathway.
21142220 Results describe the conserved water molecular dynamics of catalytic and structural Zn(+2) ions in matrix metalloproteinase 13
21107991 polymorphism of the -77 MMP-13 promoter region acts as a surrogate marker of anti-CCP antibody production in HLA-DRB1*SE allele-negative patients, which may reflect rheumatoid arthritis severity
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21039987 over-expression of Nedd4L might lead to gallbladder cancer invasion by regulating the transcription of the MMP-1 and MMP-13 genes.
20948207 Observational study of gene-disease association. (HuGE Navigator)
20936527 RT-PCR performed on samples of whole umbilical cord confirmed the transcriptional expression for the genes encoding all the six matrix metalloproteinases investigated, while in HUVEC only the expression of MMP-2, 3, 9, 10 and 13 mRNAs was detected.
20878116 that MMP13 is a secreted protein with a significant correlation to development of postoperative relapse; hence it could be a potential prognostic marker for colorectal cancer patients
20878060 the highly invasive potential of cancer stem cells depends on MMP-13 enzymatic activity, thus MMP-13 might be a potential therapeutic target for glioblastomas.
20857147 MMP-9 and -13 mRNA levels are significantly elevated in patients with chronic pain, indicating their possible synergistic effect in intervertebral disc herniation.
20827277 Observational study of gene-disease association. (HuGE Navigator)
20706991 Hyaluronan inhibits IL-1beta-induced MMP-13 and p-p38 in a concentration-dependent manner in arthritic chondrocytes, via CD44.
20685652 Nuclear S100A4 was bound to the promoter region of MMP-13 in IL-1beta-treated cells.
20683000 MMP-13 expression levels were higher in tumour tissue with liver metastasis than in that without liver metastasis. It is concluded that MMP-13 gene expression is a useful predictor of liver metastasis in patients with CRC.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20672350 Observational study of gene-disease association. (HuGE Navigator)
20667128 data show for the first time that growth stimuli are mediated via MMP13 in melanocytes and melanoma, suggesting an autocrine MMP13-driven loop
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615395 These results indicate that Glial cell line-derived neurotrophic factor (GDNF) enhances migration of glioma cells through the increase of MMP-13 production and is mainly regulated by the MEK/ERK and JNK, c-Jun and AP-1 pathways.
20587546 Observational study of gene-disease association. (HuGE Navigator)
20573369 Inhibition of MMP-13 reduces resorptive activity of the cells indicating that MMP-13 likely plays an important role giant cell tumor of bone.
20506238 MMP-13 loss leads to a breakdown in primary human articular chondrocyte differentiation by altering the expression of multiple regulatory factors.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20484597 Observational study of gene-disease association. (HuGE Navigator)
20463008 These data identify atypical PKC isozymes as STAT and ERK activators that mediate c-fos and collagenase expression.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20376807 Individuals with MMP-12 -82A/G and MMP-13 -77A/A might have higher risk of overall or special histological type of epithelial ovarian carcinoma development.
20376807 Observational study of gene-disease association. (HuGE Navigator)
20196777 there is an association among RUNX-2, SOX-9 and FGF-23 in relation to MMP-13 expression in osteoarthritic chondrocytes
20175118 Thrombin enhances the migration of chondrosarcoma cells by increasing MMP-2 and MMP-13 expression through the PAR/PLC/PKCalpha/c-Src/NF-kappaB signal transduction pathway.
20131257 miR-27b may play a role in regulating the expression of MMP-13 in human chondrocytes
20097749 HDAC4 represses matrix metalloproteinase-13 transcription in osteoblastic cells, and parathyroid hormone controls this repression
20067416 Taken together, these studies demonstrate a new level of transcriptional regulation of MMP-13 expression by the c-maf.
20043086 overexpression of ErbB2 promotes invasive and migratory abilities of H-Ras-activated MCF10A human breast epithelial cells through upregulation of matrix metalloproteinase (MMP)-13 and urokinase-type plasminogen activator (uPA).
19948051 Regulation of the IGFBP-5 and MMP-13 genes by the microRNAs miR-140 and miR-27a in human osteoarthritic chondrocytes.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902888 Membrane type-1 metalloproteinase mediates nitric oxide-induced activation of matrix metalloproteinase-13 in chondrocytes (chondrocarcoma cell line sw1353)
19883500 Adiponectin may play a significant role in the pathogenesis of rheumatoid arthritis by stimulating the production of VEGF and MMP-1 and MMP-13
19821768 Observational study of gene-disease association. (HuGE Navigator)
19787229 High MMP13 is associated with breast cancer.
19784544 Elevated HDAC7 expression in human osteoarthritis may contribute to cartilage degradation via promoting MMP-13 gene expression.
19779140 Nitric oxide may regulate the development of abdominal aortic aneurysms in part by inducing the expression of EMMPRIN and modulating the activity of MMP-13 in murine and human aneurysms.
19615667 Mutation in MMP13 determines the mode of inheritance and the clinical spectrum of metaphyseal anadysplasia.
19564415 FOXO3a promotes invasive migration by inducing the expression of matrix metalloproteinase 9 (MMP-9) and MMP-13.
19562509 Functional polymorphisms in matrix metalloproteinases might play roles in developing esophageal squamous cell carcinoma and gastric cardia adenocarcinoma in high incidence region of North China.
19562509 Observational study of gene-disease association. (HuGE Navigator)
19561643 Results indicate that Wnt5a/Ror2 signaling involves the activation of a SFK, leading to MMP-13 expression, and that constitutively active Wnt5a/Ror2 signaling confers invasive properties on osteosarcoma cells in a cell-autonomous manner.
19551542 The migration of bone marrow (BM) mesenchymal stromal cells was the result of the variable level of MMP/TIMP in response to inflammatory stimuli.
19494318 age-related shift in ALK1/ALK5 ratio in murine cartilage and a strong correlation between ALK1 and MMP-13 expression in human cartilage
19453573 Data suggest that the -77A/G and 11A/12A polymorphisms of MMP-13 gene are not associated with susceptibility to severe, generalized CP in a Turkish population. It seems that -77G allele carriage may not influence the outcome of periodontal therapy.
19442604 Primary cultures stromal cells from giant cell tumour of bone produce MMP-1 and MMP-13. Immunohistochemistry confirmed the presence of MMP-1 and MMP-13 in paraffin-embedded GCT tissue samples.
19422937 Runx2 may play a crucial role in cytokine-mediated MMP-13 expression in Giant Cell Tumor of bone stromal cells.
19415460 DDR2-mediated MMP-13 induction by collagen matrix in synovial fibroblasts of RA contributed to articular cartilage destruction
19333684 mRNA expression and protein production of IL-6, IL-8, and MMP-13, which are involved in the progression of osteoarthritis, were increased in the osteophytes
19301259 Connective tissue growth factor enhances the migration of chondrosarcoma cells by increasing MMP-13 expression through the alphavbeta3 integrin, FAK, ERK, and NF-kappaB signal transduction pathway.
19296842 15-lipoxygenases may have chondroprotective properties by reducing MMP-1 and MMP-13 expression.
19258954 the A/A genotype of MMP-13-77A/G polymorphism was associated with special pathological subtype and clinical stage in epithelial ovarian cancer at least in Chinese women.
19258954 Observational study of gene-disease association. (HuGE Navigator)
19248116 IL-7 stimulates chondrocyte secretion of S100A4 via activation of JAK/STAT signaling, and then S100A4 acts in an autocrine manner to stimulate MMP-13 production via RAGE.
19248107 Activated protein C resulted in MMP-13 activation in cartilage cultures, and it was associated with increased MMP-2 and MMP-9 activity.
19248099 C/EBPbeta directly binds to the MMP-13 promoter region and stimulates the expression of MMP-13 in chondrocytes in inflammatory arthritis.
19185056 Data show that both AF-1 and AF-2 domains of estrogen receptor alpha are required for regulation of MMP-13 promoter activity.
19180518 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19094243 Observational study of gene-disease association. (HuGE Navigator)
19038372 BMP-2 enhanced the invasiveness of chondrosarcoma cells by increasing MMP-13 expression through the PI3K, Akt, c-Fos/c-Jun and AP-1 signal transduction pathway.
18987329 Active MMP13 is suppressed in vivo and in vitro by estradiol and progesterone, suggesting a protective effect against vaginal supportive tissue deterioration.
18985055 Nuclear extracts from cells confirmed upregulation of active MMP-13 after oxygen and glucose deprivation
18976975 Knockdown of matrix metallopeptidase 13 (collagenase 3; MMP13) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
18971037 The structural changes in the venous wall in addition to the increased expression of MMP-2, MMP-9 and MMP-13 in venous aneurysms suggests a possible causal role for these MMPs in their pathogenesis.
18755271 MMP-1 and -13 differentially regulate osteoblastic markers and their combined suppression is important for the elaboration of an osteoblastic phenotype in periodontal ligament cells
18753468 MMP-13 and thioredoxin-like 2 in lungs increased in patients with COPD. MMP-13 was mainly expressed in the alveolar macrophages and type II pneumocytes
18709334 MMP-13 is over-expressed in renal cell carcinoma bone metastasis and is induced by TGF-beta1.
18593949 SRC-3/AIB1 directly regulates transcription of matrix metalloproteinase (MMP)-2 and MMP-13 through its coactivation of AP-1 and PEA3.
18528653 increases in IL-6, MMP-13, and RANKL (receptor activator of nuclear factor kappa B ligand)expression in osteoarthritis (OA) subchondral bone osteocytes suggest that in subchondral bone OA progression involves abnormal osseous tissue remodeling
18487224 CXCL12 enhances Laryngeal and hypopharyngeal squamous cell carcinoma cell invasiont through paracrine-activated CXCR4, triggering MMP-13 upregulation.
18373849 MMP-13 may be particularly useful as a prognostic marker when evaluated along with Her-2/neu and lymph node status.
18366705 MMP8, but not MMP1 or MMP13, may affect the metastatic behaviour of breast cancer cells through protection against lymph node metastasis
18308831 potential role for MMP12 -82 A/G and MMP13 -77 A/G combined polymorphisms in superficial endometriosis. As no association was found with deep infiltrating endometriosis, these polymorphisms might protect from a more in-depth penetration of tissues.
18308831 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18289383 Chondrocytes were found to express IL-7 receptors and to respond to IL-7 stimulation with increased production of matrix metalloproteinase-13.
18289056 This review highlights MMP-13, expressed by chondrocytes and synovial cells in osteoarthritis and rheumatoid arthritis and thought to play a critical role in cartilage destruction.
18262231 MMP-13 is involved in disc histopathology, and that disc cells actively participate in the synthesis of extracellular matrix-degrading proteinases
18225566 MMP-13 gene expression-related polymorphism is associated with risk for the highly aggressive form of oral cancer; the high expression A allele of the -77A/G polymorphism seems to be a prognostic factor for tumor progression
18225566 Observational study of gene-disease association. (HuGE Navigator)
18091353 the MMP-13 gene, at least in part, contributes to the development of coroonary artery lesions in Kawasaki disease
18091353 Observational study of gene-disease association. (HuGE Navigator)
18006768 Observational study of gene-disease association. (HuGE Navigator)
17905570 MyD88, IRAK1 and TRAF6 proteins are crucial early mediators for the IL-1-induced MMP-13 regulation through MAPK pathways and AP-1 activity.
17876296 ROCK-II is a critical mediator of colon cancer cell invasion through its modulation of MMP-2 and -13 at the site of invadopodia but regulates proliferation in non-malignant intestinal cells.
17853491 Fibroblasts of the interface from aseptically loosened endoprostheses selectively express MMP-13
17822788 Y-box binding protein-1 (YB-1) as a new repressor of MMP-13 transactivation.
17786186 MMP-13 may serve as a marker for progression of malignant peripheral nerve sheath tumors.
17724016 BFGF activates the MAPK and NFkappaB pathways that converge on ELK1 to control production of MMP13 by articular chondrocytes.
17697361 TauCl differentially inhibits the expression of MMP-1 and MMP-13 in human synoviocytes
17626252 Nucleolin interacts with the AP-1 site within the promoter sequence of the metalloproteinase-13 gene.
17623656 a matrix metalloprotease-13 inhibitor reduces cartilage damage in vivo without joint fibroplasia side effects
17607721 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17495113 MMP-13 is involved in osteogenic differentiation.
17395008 Increased production of reactive oxygen species but not nitric oxide as secondary messengers in the chondrocyte fibronectin fragment signaling pathway leads to increased production of MMPs, including MMP-13.
17373931 Observational study of gene-disease association. (HuGE Navigator)
17373717 CpG-ODN-treatment also increased MMP-13 activity and neutralizing anti-MMP-13 antibody prevented CpG-ODN-induced invasion in TLR9(+) CaP cells.
17311929 deregulation of cross-talk between mitogen-activated protein kinases and protein kinase Cdelta signaling may contribute to the etiology of osteoarthritis in human patients
17208315 oncostatin M-stimulated ADAMTS-4 and MMP-13 expression is mediated by extracellular signal-regulated kinases, Janus kinase 3/STAT1/3 and phosphatidylinositol 3-kinase/Akt and by cross talk between these pathways
17196980 We have solved the 2.0 A crystal structure of the complex between the catalytic domain of human MMP-13 (cdMMP-13) and bovine TIMP-2.
17151781 nicotine stimulates bone matrix turnover by increasing production of tPA and MMP-1, 2, 3, and 13, thereby tipping the balance between bone matrix formation and resorption toward the latter process
17138534 Thus, in the region of Hebei Province where there is a high incidence of GCA and ESCC, the MMP-13 A-77G SNP may not be associated with cancer susceptibility.
17138534 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17116693 These results identify an unexpectedly broad involvement for p8 in key cellular events linked to cardiomyocyte hypertrophy and cardiac fibroblast matrix metalloproteases production, both of which occur in heart failure.
17076612 activity in gingival crevicular fluid samples was significantly increased in active sites from progressive periodontal disease, supporting its role in the alveolar bone loss
17033924 Observational study of gene-disease association. (HuGE Navigator)
17033924 No convincing evidence was found to support the association of MMP13 SNPs with increased breast cancer risk or survival.
17009260 Premature induction of hypertrophy-related molecules (type X collagen and matrix metalloproteinase 13) occurred before production of type II collagen and was followed by up-regulation of alkaline phosphatase activity.
16984617 TUNEL-positive cells and MMP-3- and -13-expressing cells were distributed in the degenerative articular cartilage and reparative fibrocartilage tissue in osteochondritis dissecans (OCD) of the elbow.
16948116 Since both S100A4 and RAGE are up-regulated in osteoarthritis cartilage, this signaling pathway could contribute to cartilage degradation in this disease.
16917496 a novel role for human MMP-13 in regulating dermal fibroblast survival, proliferation, and interaction in 3D collagen.
16877349 The expression of matrix-modeling genes in chronic idiopathic myelofibrosis (cIMF) is not influenced by the JAK2 mutation status but is predominantly related to the stage of disease.
16648633 the involvement of p38 MAP kinase in the hyaluronan oligosaccharide induction of MMP-13
16507124 MMP-13 can degrade members from two classes of small leucine-rich repeat proteoglycans. Site at which biglycan is cleaved by MMP-13. MMP-13 induced SLRP degradation may represent early event affecting collagen network by exposing MMP-13 cleavage site.
16398406 MMP-13 appears to be a factor associated with tumor aggressiveness in cutaneous malignant melanoma
16356191 Observational study of gene-disease association. (HuGE Navigator)
16331612 activation of MMP-13 as well as MMP-9 induced by H-Ras is involved in angiogenesis and with farnesyl transferase inhibitors, in part, exerts their anticancer effects
16144844 GADD45beta plays an essential role during chondrocyte terminal differentiation and mediates MMP-13 gene expression
16024014 Down-regulated by integrin alphavbeta6, not essential for the degradation of type I collagen by oral squamous cell carcinoma cells.
15947272 MMP-9 and MMP-13 are involved in stroke progression and the neuroinflammatory response
15944607 Observational study of gene-disease association. (HuGE Navigator)
15763932 study showed a marked expression of MMP-13 in dental pulp tissue of both sound and carious teeth
15693018 regulation of the PLC pathway through the PTH1R is increased by elevating expression of G(11)alpha in osteoblastic cells leading to increased PTH stimulation of MMP-13 expression by increased stimulation of AP-1 factors c-jun and c-fos.
15654517 gene expression regulation in Lyme disease
15640153 MMP-1 and MMP-3 secretion by gastric epithelial cells are differentially regulated by E prostaglandins and MAPKs
15551360 MMP13 is upregulated in breast cancer
15067375 MMP-13, uPA, and PAI-1 antigen levels were determined in the synovium of patients with osteoarthritis
14558091 catabolic role of ET-1 in osteoarthritis cartilage via MMP-1 and MMP-13 up-regulation.
12974393 Together with other prognostic markers, determination of MMP-13 in ascitic fluid may help to identify patients at risk for early death and help to individualize adjuvant therapy
12878172 induction of the MMP-13 gene by TNF-alpha is mediated by ERK, p38, and JNK MAP kinases as well as AP-1 and NF-kappaB transcription factors
12734180 MMP13 expression is regulated by IGF-1 and OP-1
12426321 translational repression by an alternatively spliced form of T-cell-restricted intracellular antigen-related protein
12392760 Observational study of gene-disease association. (HuGE Navigator)
12392760 Two new MMP13 promoter polymorphisms. Genotype for one MMP13 polymorphism associated with fibrous plaque in black males. MMP13 expressed in all layers of aorta. Polymorphism a functional variant. Genetic risk factor for extent of fibrous plaque.
12270924 induction by transforming growth factor-beta via activation of p38 mitogen-activated protein kinase pathway
12192005 Data show that keratinocytes use an alternative plasminogen and matrix metalloproteinase-13-dependent pathway for dissolution of collagen fibrils.
12139441 REVIEW: The structure, regulation, and function of human matrix metalloproteinase-13
12009332 Reduction of cytokine-induced expression and activity of MMP-1 and MMP-13 by mechanical strain in MH7A rheumatoid synovial cells
12009331 involvement of MAPKs, AP-1 and NF-kappa B transcription factors in the IL-1 induction of MMPs in chondrocytes
11903048 Investigation of the role of Endo180/urokinase-type plasminogen activator receptor-associated protein as a collagenase 3 (matrix metalloproteinase 13) receptor
11883937 AGRE site plays a rate-limiting role in human collagenase-3 production.

AA Sequence

MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLRE      1 - 70
MQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKK     71 - 140
AFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSS    141 - 210
SKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKT    211 - 280
PDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFR    281 - 350
GRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI    351 - 420
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC                       421 - 471
//

Text Mined References (273)

PMID Year Title
26934732 2016 Hyaluronic Acid Suppresses the Expression of Metalloproteinases in Osteoarthritic Cartilage Stimulated Simultaneously by Interleukin 1? and Mechanical Load.
26474296 2015 Interleukin-1 Receptor Antagonist Has a Novel Function in the Regulation of Matrix Metalloproteinase-13 Expression.
26447617 2015 Modified platelet deposition on matrix metalloproteinase 13 digested collagen I.
26395178 2015 Overexpression of MMP13 in human osteoarthritic cartilage is associated with the SMAD-independent TGF-? signalling pathway.
26378022 2015 Golgi protein 73 activation of MMP-13 promotes hepatocellular carcinoma cell invasion.
26369384 2015 SENP2 regulates MMP13 expression in a bladder cancer cell line through SUMOylation of TBL1/TBLR1.
26362844 2015 Matrix metalloproteinase 13-containing exosomes promote nasopharyngeal carcinoma metastasis.
26308852 2015 RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13.
26305549 2015 Tumor microenvironment B cells increase bladder cancer metastasis via modulation of the IL-8/androgen receptor (AR)/MMPs signals.
26305372 2015 SERPINE2 Inhibits IL-1?-Induced MMP-13 Expression in Human Chondrocytes: Involvement of ERK/NF-?B/AP-1 Pathways.
26104765 2015 Shikonin inhibits invasiveness of osteosarcoma through MMP13 suppression.
26092928 2015 Elevated expression of periostin in human osteoarthritic cartilage and its potential role in matrix degradation via matrix metalloproteinase-13.
25976617 2015 P2X7 receptor stimulates breast cancer cell invasion and migration via the AKT pathway.
25966777 2015 MMP13 Regulates Aggressiveness of Pediatric Multiple Myeloma Through VEGF-C.
25948792 2015 Leptin signaling enhances cell invasion and promotes the metastasis of human pancreatic cancer via increasing MMP-13 production.
25880591 2015 Host and tumor derived MMP13 regulate extravasation and establishment of colorectal metastases in the liver.
25863779 2015 Activity of MMP1 and MMP13 and amino acid metabolism in patients with alcoholic liver cirrhosis.
25856795 2015 Acacetin inhibits expression of matrix metalloproteinases via a MAPK-dependent mechanism in fibroblast-like synoviocytes.
25846944 2015 Interleukin-32 stimulates osteosarcoma cell invasion and motility via AKT pathway-mediated MMP-13 expression.
25835975 2015 Ginsenoside Rh2 inhibits metastasis of glioblastoma multiforme through Akt-regulated MMP13.
25772251 2015 Matrix metalloproteinase 13: a potential intermediate between low expression of microRNA-125b and increasing metastatic potential of non-small cell lung cancer.
25749207 2015 Dual effects of collagenase-3 on melanoma: metastasis promotion and disruption of vasculogenic mimicry.
25742789 2015 Up-regulation of matrix metalloproteinases in a mouse model of chemically induced colitis-associated cancer: the role of microRNAs.
25609201 2015 Clusterin facilitates metastasis by EIF3I/Akt/MMP13 signaling in hepatocellular carcinoma.
25607396 2014 Matrix metalloproteinase -7, -8, -9 and -13 in gingival tissue of patients with type 1 diabetes and periodontitis.
25562781 2015 Active matrix metalloproteases are expressed early on and are high during the Barrett's esophagus malignancy sequence.
25527274 2014 Cancer progression by breast tumors with Pit-1-overexpression is blocked by inhibition of metalloproteinase (MMP)-13.
25401159 2014 Overexpression of MMP13 is associated with clinical outcomes and poor prognosis in oral squamous cell carcinoma.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25171405 2014 A secreted tyrosine kinase acts in the extracellular environment.
25166220 2014 Shedding of NG2 by MMP-13 attenuates anoikis.
25006778 Immunohistochemical expression of matrix metalloproteinase 13 in chronic periodontitis.
24974940 2014 Collagenase-3 expression in periapical lesions: an immunohistochemical study.
24781753 2015 Exome sequencing reveals a nonsense mutation in MMP13 as a new cause of autosomal recessive metaphyseal anadysplasia.
24704999 2014 Immunohistochemical analysis of matrix metalloproteinase-13 in human caries dentin.
24648384 2014 MMP13 mutations are the cause of recessive metaphyseal dysplasia, Spahr type.
24615104 2014 Association of MMP7-181A/G and MMP13-77A/G polymorphisms with colorectal cancer in a Mexican population.
24613731 2014 IL-1?-induced matrix metalloproteinase-13 is activated by a disintegrin and metalloprotease-28-regulated proliferation of human osteoblast-like cells.
24610617 2014 Clinical significance of serum matrix metalloproteinase-13 levels in patients with esophageal squamous cell carcinoma (ESCC).
24599080 2014 Osthole suppresses the migratory ability of human glioblastoma multiforme cells via inhibition of focal adhesion kinase-mediated matrix metalloproteinase-13 expression.
24563279 2014 Matrix metalloproteinase-13 expression in the progression of colorectal adenoma to carcinoma : Matrix metalloproteinase-13 expression in the colorectal adenoma and carcinoma.
24398989 2013 Expression of CXCR4, MMP-13 and ?-catenin in different histological subtypes of facial basal cell carcinoma.
24360951 2014 MiR-126-5p regulates osteoclast differentiation and bone resorption in giant cell tumor through inhibition of MMP-13.
24351915 2013 Genetic variations in MMP9 and MMP13 contribute to tooth agenesis in a Brazilian population.
24180431 2013 Knee loading reduces MMP13 activity in the mouse cartilage.
24023851 2013 Pivotal role of matrix metalloproteinase 13 in extracellular matrix turnover in idiopathic pulmonary fibrosis.
24008762 2013 SUMO-specific protease 2 suppresses cell migration and invasion through inhibiting the expression of MMP13 in bladder cancer cells.
23913860 2013 Crystal structure of full-length human collagenase 3 (MMP-13) with peptides in the active site defines exosites in the catalytic domain.
23898086 2013 Gene polymorphism of matrix metalloproteinase-12 and -13 and association with colorectal cancer in Swedish patients.
23847446 2013 1,25-Dihydroxyvitamin D3 activates MMP13 gene expression in chondrocytes through p38 MARK pathway.
23810497 2013 Hydantoin based inhibitors of MMP13--discovery of AZD6605.
23762330 2013 A feedback inhibition between miRNA-127 and TGF?/c-Jun cascade in HCC cell migration via MMP13.
23732700 2013 MicroRNA-143 inhibits cell migration and invasion by targeting matrix metalloproteinase 13 in prostate cancer.
23665089 2013 Differential expression of matrix metalloproteinase-13 in mucinous and nonmucinous colorectal carcinomas.
23467939 2013 Expression of MMP-13 is associated with invasion and metastasis of papillary thyroid carcinoma.
23465389 2013 The relationship of metalloproteinase gene polymorphisms and lung cancer.
23417678 2013 Regulated transcription of human matrix metalloproteinase 13 (MMP13) and interleukin-1? (IL1B) genes in chondrocytes depends on methylation of specific proximal promoter CpG sites.
23334990 2013 Matrix metalloproteinase 13 expression in response to double-stranded RNA in human chondrocytes.
23162804 2012 S100A4 promotes invasion and angiogenesis in breast cancer MDA-MB-231 cells by upregulating matrix metalloproteinase-13.
23132541 2013 Phosphorylation of osteopontin in osteoarthritis degenerative cartilage and its effect on matrix metalloprotease 13.
22992737 2012 Matrix metalloproteinase-13 (MMP-13) directly and indirectly promotes tumor angiogenesis.
22950625 2012 Clinicopathological significance and prognostic value of MMP-13 expression in colorectal cancer.
22869368 2012 Osterix regulates calcification and degradation of chondrogenic matrices through matrix metalloproteinase 13 (MMP13) expression in association with transcription factor Runx2 during endochondral ossification.
22782903 2012 MicroRNA-125b down-regulates matrix metallopeptidase 13 and inhibits cutaneous squamous cell carcinoma cell proliferation, migration, and invasion.
22722466 2013 Expression of matrix metalloproteinase-13 and Ki-67 in nonmelanoma skin cancer in xeroderma pigmentosum and non-xeroderma pigmentosum.
22710868 2012 Matrix metalloproteinase 13 genotype in rs640198 polymorphism is associated with severe coronary artery disease.
22710194 2012 MMP13 polymorphism decreases risk for dental caries.
22689580 2012 Simple pseudo-dipeptides with a P2' glutamate: a novel inhibitor family of matrix metalloproteases and other metzincins.
22610965 2012 ?-adrenergic receptor stimulation transactivates protease-activated receptor 1 via matrix metalloproteinase 13 in cardiac cells.
22590832 2011 AT1 receptors activation enhances the expression of MMP-2, MMP-13 and VEGF but not MMP-9 in B16F10 melanoma cells.
22573319 2012 Defining requirements for collagenase cleavage in collagen type III using a bacterial collagen system.
22505473 2012 cAMP response element-binding (CREB) recruitment following a specific CpG demethylation leads to the elevated expression of the matrix metalloproteinase 13 in human articular chondrocytes and osteoarthritis.
22488635 2012 Effect of the expression of matrix metalloproteases and their tissue inhibitors on survival of patients with resectable colorectal cancer.
22327326 2012 Possible role of matrix metalloproteinases (MMPs) in hyperostosis of intracranial meningiomas.
22273691 2012 MiRNA-140 is a negative feedback regulator of MMP-13 in IL-1?-stimulated human articular chondrocyte C28/I2 cells.
22270366 2012 ETS-1 protein regulates vascular endothelial growth factor-induced matrix metalloproteinase-9 and matrix metalloproteinase-13 expression in human ovarian carcinoma cell line SKOV-3.
22158614 2012 E74-like factor 3 (ELF3) impacts on matrix metalloproteinase 13 (MMP13) transcriptional control in articular chondrocytes under proinflammatory stress.
22153941 2012 Lead optimisation of selective non-zinc binding inhibitors of MMP13. Part 2.
22128168 2012 Dissection of Wnt5a-Ror2 signaling leading to matrix metalloproteinase (MMP-13) expression.
22102411 2012 Distal interleukin-1? (IL-1?) response element of human matrix metalloproteinase-13 (MMP-13) binds activator protein 1 (AP-1) transcription factors and regulates gene expression.
22095691 2012 C/EBP? and RUNX2 cooperate to degrade cartilage with MMP-13 as the target and HIF-2? as the inducer in chondrocytes.
22084953 2012 Prognostic significance of matrix metalloproteinase-2, -8, -9, and -13 in oral tongue cancer.
22032644 2011 MMP-13 stimulates osteoclast differentiation and activation in tumour breast bone metastases.
22006368 2012 Mechanical forces-induced human osteoblasts differentiation involves MMP-2/MMP-13/MT1-MMP proteolytic cascade.
21959927 2012 Endothelin-1 promotes MMP-13 production and migration in human chondrosarcoma cells through FAK/PI3K/Akt/mTOR pathways.
21938739 2012 Oct-3/4 promotes migration and invasion of glioblastoma cells.
21913037 2012 Implication of MMP-9 and urokinase plasminogen activator (uPA) in the activation of pro-matrix metalloproteinase (MMP)-13.
21881840 2012 Expression of matrix metalloproteinase-1, -9, -13, and tissue inhibitor of metalloproteinases-1 in basal cell carcinomas of the eyelid.
21849805 2011 Matrix metalloproteinase-13 promotes recovery from experimental liver cirrhosis in rats.
21720458 2011 Rosuvastatin therapy does not affect serum MMP-13 or TIMP-1 levels in hypercholesterolemic patients.
21539914 2011 Divergent upstream osteogenic events contribute to the differential modulation of MG63 cell osteoblast differentiation by MMP-1 (collagenase-1) and MMP-13 (collagenase-3).
21508380 2011 Induction of MMP-13 expression in bone-metastasizing cancer cells by type I collagen through integrin ?1?1 and ?2?1-p38 MAPK signaling.
21437966 2011 Autologous protein solution inhibits MMP-13 production by IL-1? and TNF?-stimulated human articular chondrocytes.
21344384 2011 15-deoxy-?(12,14) -prostaglandin-J2 and ciglitazone inhibit TNF-?-induced matrix metalloproteinase 13 production via the antagonism of NF-?B activation in human synovial fibroblasts.
21344378 2011 CCN3 increases cell motility and MMP-13 expression in human chondrosarcoma through integrin-dependent pathway.
21339746 2011 MUC1 induces metastasis in esophageal squamous cell carcinoma by upregulating matrix metalloproteinase 13.
21278254 2011 IL-6 increases MMP-13 expression and motility in human chondrosarcoma cells.
21211511 2011 Involvement of H-Ras and reactive oxygen species in proinflammatory cytokine-induced matrix metalloproteinase-13 expression in human articular chondrocytes.
21205837 2011 CXCR4 promotes oral squamous cell carcinoma migration and invasion through inducing expression of MMP-9 and MMP-13 via the ERK signaling pathway.
21191416 2011 Expression of matrix metalloproteinase-13 is controlled by IL-13 via PI3K/Akt3 and PKC-? in normal human dermal fibroblasts.
21187486 2010 Parathyroid hormone-related peptide regulates matrix metalloproteinase-13 gene expression in bone metastatic breast cancer cells.
21142220 2011 An insight to conserved water molecular dynamics of catalytic and structural Zn(+2) ions in matrix metalloproteinase 13 of human.
21107991 2011 Contribution of an adenine to guanine single nucleotide polymorphism of the matrix metalloproteinase-13 (MMP-13) -77 promoter region to the production of anticyclic citrullinated peptide antibodies in patients with HLA-DRB1*shared epitope-negative rheumatoid arthritis.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21039987 2011 Nedd4L modulates the transcription of metalloproteinase-1 and -13 genes to increase the invasive activity of gallbladder cancer.
20948207 2010 Association of a functional polymorphism in the MMP-3 gene with Moyamoya Disease in the Chinese Han population.
20936527 2010 Immunohistochemical and transcriptional expression of matrix metalloproteinases in full-term human umbilical cord and human umbilical vein endothelial cells.
20878116 2010 MMP13 is a potential prognostic marker for colorectal cancer.
20878060 2010 Cancer stem-like cells of glioblastoma characteristically express MMP-13 and display highly invasive activity.
20857147 2011 Transcript levels of major MMPs and ADAMTS-4 in relation to the clinicopathological profile of patients with lumbar disc herniation.
20827277 2010 Matrix metalloproteinase haplotypes associated with coronary artery aneurysm formation in patients with Kawasaki disease.
20726512 2010 Orally active MMP-1 sparing ?-tetrahydropyranyl and ?-piperidinyl sulfone matrix metalloproteinase (MMP) inhibitors with efficacy in cancer, arthritis, and cardiovascular disease.
20706991 2011 Hyaluronan inhibits matrix metalloproteinase-13 in human arthritic chondrocytes via CD44 and P38.
20685652 2010 Sumoylation and nuclear translocation of S100A4 regulate IL-1beta-mediated production of matrix metalloproteinase-13.
20683000 2010 Overexpression of MMP-13 gene in colorectal cancer with liver metastasis.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20667128 2010 MMP13 mediates cell cycle progression in melanocytes and melanoma cells: in vitro studies of migration and proliferation.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615395 2010 Glial cell line-derived neurotrophic factor induces cell migration and matrix metalloproteinase-13 expression in glioma cells.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20573369 2010 Evidence for the role of matrix metalloproteinase-13 in bone resorption by giant cell tumor of bone.
20506238 2010 Matrix metalloproteinase 13 loss associated with impaired extracellular matrix remodeling disrupts chondrocyte differentiation by concerted effects on multiple regulatory factors.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20484597 2010 Association of matrix metalloproteinase gene polymorphisms with refractive error in Amish and Ashkenazi families.
20463008 2010 Protein kinase C isoforms zeta and iota mediate collagenase expression and cartilage destruction via STAT3- and ERK-dependent c-fos induction.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20376807 2010 [Association of functional polymorphisms on MMP-12 and MMP-13 gene promoter region with epithelial ovarian carcinoma].
20196777 2009 Involvement of SOX-9 and FGF-23 in RUNX-2 regulation in osteoarthritic chondrocytes.
20175118 2010 Thrombin enhanced migration and MMPs expression of human chondrosarcoma cells involves PAR receptor signaling pathway.
20131257 2010 MicroRNA-27b regulates the expression of matrix metalloproteinase 13 in human osteoarthritis chondrocytes.
20097749 2010 HDAC4 represses matrix metalloproteinase-13 transcription in osteoblastic cells, and parathyroid hormone controls this repression.
20067416 2010 Transcriptional activation of human MMP-13 gene expression by c-Maf in osteoarthritic chondrocyte.
20043086 2010 ErbB2-enhanced invasiveness of H-Ras MCF10A breast cells requires MMP-13 and uPA upregulation via p38 MAPK signaling.
20005097 2010 Discovery of (pyridin-4-yl)-2H-tetrazole as a novel scaffold to identify highly selective matrix metalloproteinase-13 inhibitors for the treatment of osteoarthritis.
19948051 2009 Regulation of the IGFBP-5 and MMP-13 genes by the microRNAs miR-140 and miR-27a in human osteoarthritic chondrocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902888 2009 Membrane type-1 metalloproteinase mediates nitric oxide-induced activation of matrix metalloproteinase-13.
19883500 2009 Adiponectin may contribute to synovitis and joint destruction in rheumatoid arthritis by stimulating vascular endothelial growth factor, matrix metalloproteinase-1, and matrix metalloproteinase-13 expression in fibroblast-like synoviocytes more than proinflammatory mediators.
19821768 2010 A functional polymorphism in MMP1 could influence osteomyelitis development.
19787229 2009 MMP13 is potentially a new tumor marker for breast cancer diagnosis.
19784544 2010 Correlation between MMP-13 and HDAC7 expression in human knee osteoarthritis.
19779140 2009 Nitric oxide induces the progression of abdominal aortic aneurysms through the matrix metalloproteinase inducer EMMPRIN.
19615667 2009 Mutations in MMP9 and MMP13 determine the mode of inheritance and the clinical spectrum of metaphyseal anadysplasia.
19564415 2009 FOXO3a promotes tumor cell invasion through the induction of matrix metalloproteinases.
19562509 2010 Association of functional polymorphisms in MMPs genes with gastric cardia adenocarcinoma and esophageal squamous cell carcinoma in high incidence region of North China.
19561643 2009 Autonomous regulation of osteosarcoma cell invasiveness by Wnt5a/Ror2 signaling.
19551542 2009 In vitro study of matrix metalloproteinase/tissue inhibitor of metalloproteinase production by mesenchymal stromal cells in response to inflammatory cytokines: the role of their migration in injured tissues.
19494318 2009 Increase in ALK1/ALK5 ratio as a cause for elevated MMP-13 expression in osteoarthritis in humans and mice.
19453573 2009 MMP-13 promoter polymorphisms in patients with chronic periodontitis: effects on GCF MMP-13 levels and outcome of periodontal therapy.
19442604 2009 Collagenase expression and activity in the stromal cells from giant cell tumour of bone.
19422937 2009 Upregulation of MMP-13 via Runx2 in the stromal cell of Giant Cell Tumor of bone.
19422229 2009 Discovery of potent, selective, and orally active carboxylic acid based inhibitors of matrix metalloproteinase-13.
19415460 2009 Discoidin domain receptor 2 is associated with the increased expression of matrix metalloproteinase-13 in synovial fibroblasts of rheumatoid arthritis.
19333684 2009 Osteoblasts derived from osteophytes produce interleukin-6, interleukin-8, and matrix metalloproteinase-13 in osteoarthritis.
19301259 2009 CTGF enhances migration and MMP-13 up-regulation via alphavbeta3 integrin, FAK, ERK, and NF-kappaB-dependent pathway in human chondrosarcoma cells.
19296842 2009 Human articular chondrocytes express 15-lipoxygenase-1 and -2: potential role in osteoarthritis.
19258954 2009 The functional polymorphisms on promoter region of matrix metalloproteinase-12, -13 genes may alter the risk of epithelial ovarian carcinoma in Chinese.
19248116 2009 Interleukin-7 stimulates secretion of S100A4 by activating the JAK/STAT signaling pathway in human articular chondrocytes.
19248107 2009 Activation of cartilage matrix metalloproteinases by activated protein C.
19248099 2009 CCAAT/enhancer binding protein beta mediates expression of matrix metalloproteinase 13 in human articular chondrocytes in inflammatory arthritis.
19185056 2009 Distinct roles for AF-1 and -2 of ER-alpha in regulation of MMP-13 promoter activity.
19180518 2009 Associations of 25 structural, degradative, and inflammatory candidate genes with lumbar disc desiccation, bulging, and height narrowing.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19094243 2008 Polymorphism +17 C/G in matrix metalloprotease MMP8 decreases lung cancer risk.
19038372 2009 Bone morphogenetic protein-2 enhances the motility of chondrosarcoma cells via activation of matrix metalloproteinase-13.
18987329 2009 The amount and activity of active matrix metalloproteinase 13 is suppressed by estradiol and progesterone in human pelvic floor fibroblasts.
18985055 2009 Matrix metalloproteinase-13 is activated and is found in the nucleus of neural cells after cerebral ischemia.
18971037 2008 Metalloproteinase expression in venous aneurysms.
18755271 2008 MMP-1 (collagenase-1) and MMP-13 (collagenase-3) differentially regulate markers of osteoblastic differentiation in osteogenic cells.
18753468 2009 Proteomic analysis in lung tissue of smokers and COPD patients.
18709334 2008 MMP-13 is over-expressed in renal cell carcinoma bone metastasis and is induced by TGF-beta1.
18593949 2008 Steroid receptor coactivator-3/AIB1 promotes cell migration and invasiveness through focal adhesion turnover and matrix metalloproteinase expression.
18528653 2008 Enhanced expression of interleukin-6, matrix metalloproteinase-13, and receptor activator of NF-kappaB ligand in cells derived from osteoarthritic subchondral bone.
18487224 2008 CXCL12/CXCR4 promotes laryngeal and hypopharyngeal squamous cell carcinoma metastasis through MMP-13-dependent invasion via the ERK1/2/AP-1 pathway.
18373849 2008 Tumor-derived matrix metalloproteinase-13 (MMP-13) correlates with poor prognoses of invasive breast cancer.
18366705 2008 Plasma MMP1 and MMP8 expression in breast cancer: protective role of MMP8 against lymph node metastasis.
18308831 2008 Genetic polymorphisms of matrix metalloproteinase 12 and 13 genes are implicated in endometriosis progression.
18289383 2008 Human articular chondrocytes produce IL-7 and respond to IL-7 with increased production of matrix metalloproteinase-13.
18289056 2008 Joint diseases and matrix metalloproteinases: a role for MMP-13.
18262231 2008 MMP-13 (collagenase 3) localization in human temporomandibular joint discs with internal derangement.
18225566 A metalloproteinase-13 polymorphism affecting its gene expression is associated with advanced stages of oral cancer.
18091353 2008 Genetic analysis of MMP gene polymorphisms in patients with Kawasaki disease.
18006768 2007 Matrix metalloproteinase single-nucleotide polymorphisms and haplotypes predict breast cancer progression.
17905570 2007 MyD88, IRAK1 and TRAF6 knockdown in human chondrocytes inhibits interleukin-1-induced matrix metalloproteinase-13 gene expression and promoter activity by impairing MAP kinase activation.
17876296 2007 ROCK-II mediates colon cancer invasion via regulation of MMP-2 and MMP-13 at the site of invadopodia as revealed by multiphoton imaging.
17853491 2008 Interface membrane fibroblasts around aseptically loosened endoprostheses express MMP-13.
17822788 YB-1 binds to the MMP-13 promoter sequence and represses MMP-13 transactivation via the AP-1 site.
17786186 2007 MMP-13 and p53 in the progression of malignant peripheral nerve sheath tumors.
17724016 2007 Basic fibroblast growth factor activates the MAPK and NFkappaB pathways that converge on Elk-1 to control production of matrix metalloproteinase-13 by human adult articular chondrocytes.
17697361 2007 Taurine chloramine differentially inhibits matrix metalloproteinase 1 and 13 synthesis in interleukin-1beta stimulated fibroblast-like synoviocytes.
17626252 2008 Nucleolin binds specifically to an AP-1 DNA sequence and represses AP1-dependent transactivation of the matrix metalloproteinase-13 gene.
17623656 2007 Discovery and characterization of a novel inhibitor of matrix metalloprotease-13 that reduces cartilage damage in vivo without joint fibroplasia side effects.
17607721 2007 Functional polymorphisms and haplotypes in the promoter of the MMP2 gene are associated with risk of nasopharyngeal carcinoma.
17495113 2007 Matrix metalloprotease activity is an essential link between mechanical stimulus and mesenchymal stem cell behavior.
17395008 2007 Endogenous production of reactive oxygen species is required for stimulation of human articular chondrocyte matrix metalloproteinase production by fibronectin fragments.
17373931 2007 Variation in the matrix metalloproteinase-3, -7, -12 and -13 genes is associated with functional status in rheumatoid arthritis.
17373717 2007 Toll like receptor-9 agonists stimulate prostate cancer invasion in vitro.
17311929 2007 Basic fibroblast growth factor stimulates matrix metalloproteinase-13 via the molecular cross-talk between the mitogen-activated protein kinases and protein kinase Cdelta pathways in human adult articular chondrocytes.
17300926 2007 Inhibition of aggrecan turnover in short-term explant cultures of bovine tendon.
17208315 2007 Signaling pathways implicated in oncostatin M-induced aggrecanase-1 and matrix metalloproteinase-13 expression in human articular chondrocytes.
17196980 2007 Flexibility and variability of TIMP binding: X-ray structure of the complex between collagenase-3/MMP-13 and TIMP-2.
17151781 2006 Nicotine treatment induces expression of matrix metalloproteinases in human osteoblastic Saos-2 cells.
17138534 2006 [The association of MMP-13 polymorphism with susceptibility to esophageal squamous cell carcinoma and gastric cardiac adenocarcinoma].
17116693 2007 Helix-loop-helix protein p8, a transcriptional regulator required for cardiomyocyte hypertrophy and cardiac fibroblast matrix metalloprotease induction.
17076612 2006 Matrix metalloproteinase-13 is highly expressed in destructive periodontal disease activity.
17033924 2007 Promoter polymorphisms in matrix metalloproteinases and their inhibitors: few associations with breast cancer susceptibility and progression.
17009260 2006 Premature induction of hypertrophy during in vitro chondrogenesis of human mesenchymal stem cells correlates with calcification and vascular invasion after ectopic transplantation in SCID mice.
16984617 2006 Osteochondritis dissecans of the elbow: histopathological assessment of the articular cartilage and subchondral bone with emphasis on their damage and repair.
16948116 2006 Increase in production of matrix metalloproteinase 13 by human articular chondrocytes due to stimulation with S100A4: Role of the receptor for advanced glycation end products.
16917496 2007 Collagenase-3 (MMP-13) enhances remodeling of three-dimensional collagen and promotes survival of human skin fibroblasts.
16877349 2006 Aberrant collagenase expression in chronic idiopathic myelofibrosis is related to the stage of disease but not to the JAK2 mutation status.
16648633 2006 Hyaluronan oligosaccharides induce matrix metalloproteinase 13 via transcriptional activation of NFkappaB and p38 MAP kinase in articular chondrocytes.
16507124 2006 Degradation of small leucine-rich repeat proteoglycans by matrix metalloprotease-13: identification of a new biglycan cleavage site.
16398406 Collagenase-3 (MMP-13) expression in cutaneous malignant melanoma.
16356191 2006 Regulatory polymorphisms in extracellular matrix protease genes and susceptibility to rheumatoid arthritis: a case-control study.
16331612 2006 Confirmation of a linkage between H-Ras and MMP-13 expression as well as MMP-9 by chemical genomic approach.
16167086 2005 MMP13 mutation causes spondyloepimetaphyseal dysplasia, Missouri type (SEMD(MO).
16144844 2005 A novel role for GADD45beta as a mediator of MMP-13 gene expression during chondrocyte terminal differentiation.
16024014 2005 Alpha v beta 6 integrin down-regulates the MMP-13 expression in oral squamous cell carcinoma cells.
15947272 2005 A matrix metalloproteinase protein array reveals a strong relation between MMP-9 and MMP-13 with diffusion-weighted image lesion increase in human stroke.
15944607 2005 Genetic analysis of polymorphisms in biologically relevant candidate genes in patients with abdominal aortic aneurysms.
15780611 2005 Potent pyrimidinetrione-based inhibitors of MMP-13 with enhanced selectivity over MMP-14.
15763932 2004 Matrix metalloproteinase-13 (MMP-13, collagenase-3) is highly expressed in human tooth pulp.
15734645 2005 Structural basis for the highly selective inhibition of MMP-13.
15693018 2005 Increased expression of G11alpha in osteoblastic cells enhances parathyroid hormone activation of phospholipase C and AP-1 regulation of matrix metalloproteinase-13 mRNA.
15654517 2004 Differential expression of matrix metalloproteinases and cyclooxygenases in synovial cells exposed to Borrelia burgdorferi.
15640153 2005 Matrix metalloproteinase secretion by gastric epithelial cells is regulated by E prostaglandins and MAPKs.
15551360 2005 Upregulation of matrix metalloproteinases (MMPs) in breast cancer xenografts: a major induction of stromal MMP-13.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15067375 2004 Protein expression of MMP-13, uPA, and PAI-1 in pseudocapsular and interface tissue around implants of loose artificial hip joints and in osteoarthritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14558091 2003 Endothelin 1 promotes osteoarthritic cartilage degradation via matrix metalloprotease 1 and matrix metalloprotease 13 induction.
12974393 2003 Clinical relevance of matrix metalloproteinase-13 determined with a new highly specific and sensitive ELISA in ascitic fluid of advanced ovarian carcinoma patients.
12878172 2003 Induction of matrix metalloproteinase-13 gene expression by TNF-alpha is mediated by MAP kinases, AP-1, and NF-kappaB transcription factors in articular chondrocytes.
12814616 2003 Identification and differential expression of human collagenase-3 mRNA species derived from internal deletion, alternative splicing, and different polyadenylation and transcription initiation sites.
12734180 2003 Inhibitory effects of insulin-like growth factor-1 and osteogenic protein-1 on fibronectin fragment- and interleukin-1beta-stimulated matrix metalloproteinase-13 expression in human chondrocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426321 2003 Translational repression of human matrix metalloproteinases-13 by an alternatively spliced form of T-cell-restricted intracellular antigen-related protein (TIAR).
12392760 2002 MMP13 promoter polymorphism is associated with atherosclerosis in the abdominal aorta of young black males.
12270924 2002 Smad3 mediates transforming growth factor-beta-induced collagenase-3 (matrix metalloproteinase-13) expression in human gingival fibroblasts. Evidence for cross-talk between Smad3 and p38 signaling pathways.
12192005 2002 Collagen dissolution by keratinocytes requires cell surface plasminogen activation and matrix metalloproteinase activity.
12149192 2002 Matrix metalloproteinase processing of monocyte chemoattractant proteins generates CC chemokine receptor antagonists with anti-inflammatory properties in vivo.
12139441 2002 The structure, regulation, and function of human matrix metalloproteinase-13.
12009332 2002 Reduction of cytokine-induced expression and activity of MMP-1 and MMP-13 by mechanical strain in MH7A rheumatoid synovial cells.
12009331 2002 Inhibition of interleukin-1-stimulated MAP kinases, activating protein-1 (AP-1) and nuclear factor kappa B (NF-kappa B) transcription factors down-regulates matrix metalloproteinase gene expression in articular chondrocytes.
11903048 2002 Investigation of the role of Endo180/urokinase-type plasminogen activator receptor-associated protein as a collagenase 3 (matrix metalloproteinase 13) receptor.
11108860 Ovulation: a multi-gene, multi-step process.
11032846 2000 Mutations in the interglobular domain of aggrecan alter matrix metalloproteinase and aggrecanase cleavage patterns. Evidence that matrix metalloproteinase cleavage interferes with aggrecanase activity.
10986281 2000 Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.
10986126 2000 High-resolution solution structure of the catalytic fragment of human collagenase-3 (MMP-13) complexed with a hydroxamic acid inhibitor.
10949161 2000 Structural differences of matrix metalloproteinases. Homology modeling and energy minimization of enzyme-substrate complexes.
10947989 2000 Inflammation dampened by gelatinase A cleavage of monocyte chemoattractant protein-3.
10930399 2000 Matrix metalloproteinases collagenase-2, macrophage elastase, collagenase-3, and membrane type 1-matrix metalloproteinase impair clotting by degradation of fibrinogen and factor XII.
10926524 2000 Solution structure of the catalytic domain of human collagenase-3 (MMP-13) complexed to a potent non-peptidic sulfonamide inhibitor: binding comparison with stromelysin-1 and collagenase-1.
10788434 2000 Hydrolysis of triple-helical collagen peptide models by matrix metalloproteinases.
10514495 1999 Collagenase-3 binds to a specific receptor and requires the low density lipoprotein receptor-related protein for internalization.
10419448 1999 Matrix metalloproteinases.
10074939 1999 Crystal structures of MMP-1 and -13 reveal the structural basis for selectivity of collagenase inhibitors.
9562863 1998 A matrix metalloproteinase gene expressed in human T lymphocytes is identical with collagenase 3 from breast carcinomas.
9119388 1997 Structural analysis and promoter characterization of the human collagenase-3 gene (MMP13).
9065415 1997 The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.
9056642 1997 Collagenase-3 (MMP-13) is expressed by hypertrophic chondrocytes, periosteal cells, and osteoblasts during human fetal bone development.
8969305 1996 The helping hand of collagenase-3 (MMP-13): 2.7 A crystal structure of its C-terminal haemopexin-like domain.
8798568 1996 Cytokine control of interstitial collagenase and collagenase-3 gene expression in human chondrocytes.
8663255 1996 Cellular mechanisms for human procollagenase-3 (MMP-13) activation. Evidence that MT1-MMP (MMP-14) and gelatinase a (MMP-2) are able to generate active enzyme.
8609233 1996 Cloning, expression, and type II collagenolytic activity of matrix metalloproteinase-13 from human osteoarthritic cartilage.
8603731 1996 Degradation of cartilage aggrecan by collagenase-3 (MMP-13).
8576151 1996 Biochemical characterization of human collagenase-3.
8207000 1994 Molecular cloning and expression of collagenase-3, a novel human matrix metalloproteinase produced by breast carcinomas.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7607691 1995 The human collagenase-3 (CLG3) gene is located on chromosome 11q22.3 clustered to other members of the matrix metalloproteinase gene family.