Property Summary

NCBI Gene PubMed Count 18
PubMed Score 23.02
PubTator Score 18.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adult high grade glioma -1.100 3.5e-04
astrocytic glioma -1.400 2.2e-03
Astrocytoma, Pilocytic -1.100 2.2e-06
atypical teratoid / rhabdoid tumor -1.900 2.4e-04
autosomal dominant Emery-Dreifuss muscul... 1.931 4.2e-03
Becker muscular dystrophy 1.501 1.7e-02
Breast cancer 1.200 1.6e-05
COPD 1.300 1.6e-02
cutaneous lupus erythematosus 1.500 2.6e-03
cystic fibrosis 1.100 2.0e-03
Duchenne muscular dystrophy 1.539 9.6e-06
ductal carcinoma in situ 2.100 2.3e-03
ependymoma -3.200 3.6e-02
fibroadenoma 1.300 7.9e-03
glioblastoma -1.800 4.2e-02
interstitial cystitis 1.400 5.4e-04
intraductal papillary-mucinous adenoma (... -1.400 1.1e-02
intraductal papillary-mucinous carcinoma... -2.000 3.2e-03
invasive ductal carcinoma 4.100 4.2e-04
juvenile dermatomyositis 2.387 6.0e-09
limb girdle muscular dystrophy 2A 1.363 2.1e-03
lung cancer 3.400 2.5e-05
lung carcinoma 1.700 3.4e-20
non-small cell lung cancer 1.913 5.1e-08
oligodendroglioma -1.100 2.1e-02
osteosarcoma 2.287 3.8e-03
ovarian cancer 2.200 1.4e-04
Pick disease -1.500 9.0e-03
pituitary cancer 1.700 1.9e-07

Gene RIF (13)

AA Sequence

MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYS      1 - 70
TFNFWRAPIASIHSFELDLL                                                       71 - 90
//

Text Mined References (19)

PMID Year Title