Property Summary

NCBI Gene PubMed Count 25
PubMed Score 283.07
PubTator Score 119.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.9e-08
adult high grade glioma 2148 2.2e-03
Disease Target Count Z-score Confidence
Cancer 2346 4.036 2.0
Disease Target Count Z-score Confidence
Leprosy 77 6.727 3.4
Neuritis 6 4.147 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.900 1.9e-08
adult high grade glioma -1.200 2.2e-03

 GO Function (1)

Gene RIF (20)

PMID Text
26635203 Recurrent mutations within Wilms tumours involve the highly conserved YEATS domain of MLLT1.
25921070 Data suggest that AT mutated protein ATM-dependent phosphorylation of ENL (MLLT1) protein functions as switch from elongation to Polycomb-mediated repression to preserve genome integrity.
25509985 AF9 and its homolog ENL directly interact with AF4.
25481096 Novel splice isoform of Mllt1 is documented and confirmed that both Mllt1 mRNA isoforms are translated. The data support that MLLT1 protein isoforms display distinct stage-specific expression during spermiogenesis and adult tissues.
24367103 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23623499 MLL-ENL Interaction with CBX8 Is Required for Efficient Transformation.
23518577 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23251033 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
22567366 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
22355797 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
22190034 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
21953510 Data from a follow-up study in Rome suggest a particularly favorable prognosis for patients with acute lymphoblastic leukemia expressing the MLL/ENL fusion gene.
21360054 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
20471949 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
20471948 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20113834 Three-way translocation involving MLL, MLLT1, and a novel third partner, NRXN1, in a patient with acute lymphoblastic leukemia and t(2;19;11) (p12;p13.3;q23).
17252016 In acute leukemias with a t(11:19) translocation, 50% of the analyzed breakpoints were within the MLLT1 gene introns. The MLL gene was fused to the intact MLLT1 gene by transcriptional readthrough & a splice event, or by trans-splicing.
16433901 determination of the relative positions of MLL, AF4 and ENL genes, in two lymphoblastic and two myeloid human cell lines
12665591 ENL chromatin-remodeling complexes contain a mixed-lineage leukemia chromosomal translocation partner.

AA Sequence

MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPP      1 - 70
YKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGG     71 - 140
VMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSE    141 - 210
SKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKETKLESTSPKGGPPPPPPPPP    211 - 280
RASSKRPATADSPKPSAKKQKKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPREA    281 - 350
KKALEVEESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDEDDSS    351 - 420
SGEEAAGKTNPGRDSRLSFSDSESDNSADSSLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGT    421 - 490
YDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVAT     491 - 559
//

Text Mined References (35)

PMID Year Title
26635203 2015 MLLT1 YEATS domain mutations in clinically distinctive Favourable Histology Wilms tumours.
25921070 2015 Transcriptional elongation factor ENL phosphorylated by ATM recruits polycomb and switches off transcription for DSB repair.
25509985 2014 An AF9/ENL-targted peptide with therapeutic potential in mixed lineage leukemias.
25481096 2015 Identification of a novel isoform of the leukemia-associated MLLT1 (ENL/LTG19) protein.
23623499 2013 MLL-ENL inhibits polycomb repressive complex 1 to achieve efficient transformation of hematopoietic cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21953510 2011 Clinical outcome and monitoring of minimal residual disease in patients with acute lymphoblastic leukemia expressing the MLL/ENL fusion gene.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
20471948 2010 HIV-1 Tat and host AFF4 recruit two transcription elongation factors into a bifunctional complex for coordinated activation of HIV-1 transcription.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20203130 2010 Linking H3K79 trimethylation to Wnt signaling through a novel Dot1-containing complex (DotCom).
20159561 2010 AFF4, a component of the ELL/P-TEFb elongation complex and a shared subunit of MLL chimeras, can link transcription elongation to leukemia.
20153263 2010 A higher-order complex containing AF4 and ENL family proteins with P-TEFb facilitates oncogenic and physiologic MLL-dependent transcription.
20113834 2010 Three-way translocation involving MLL, MLLT1, and a novel third partner, NRXN1, in a patient with acute lymphoblastic leukemia and t(2;19;11) (p12;p13.3;q23).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17252016 2007 Spliced MLL fusions: a novel mechanism to generate functional chimeric MLL-MLLT1 transcripts in t(11;19)(q23;p13.3) leukemia.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16433901 2006 Simultaneous localization of MLL, AF4 and ENL genes in interphase nuclei by 3D-FISH: MLL translocation revisited.
12665591 2003 Novel SWI/SNF chromatin-remodeling complexes contain a mixed-lineage leukemia chromosomal translocation partner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11526240 2001 Molecular emergence of acute myeloid leukemia during treatment for acute lymphoblastic leukemia.
11313972 2001 The ENL moiety of the childhood leukemia-associated MLL-ENL oncoprotein recruits human Polycomb 3.
10995463 2000 Retrovirus-mediated gene transfer of MLL-ELL transforms primary myeloid progenitors and causes acute myeloid leukemias in mice.
8378076 1993 Two distinct portions of LTG19/ENL at 19p13 are involved in t(11;19) leukemia.
8080983 1994 ENL, the gene fused with HRX in t(11;19) leukemias, encodes a nuclear protein with transcriptional activation potential in lymphoid and myeloid cells.
7991593 1994 Cloning of ELL, a gene that fuses to MLL in a t(11;19)(q23;p13.1) in acute myeloid leukemia.
1423624 1992 Involvement of a homolog of Drosophila trithorax by 11q23 chromosomal translocations in acute leukemias.