Property Summary

NCBI Gene PubMed Count 15
PubMed Score 26.80
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 2.0e-02
oligodendroglioma -1.100 1.0e-08
glioblastoma -2.300 2.1e-03
medulloblastoma -3.700 1.7e-10
atypical teratoid / rhabdoid tumor -2.900 3.4e-04
medulloblastoma, large-cell -3.300 1.0e-05
primitive neuroectodermal tumor -3.800 3.6e-06
posterior fossa group B ependymoma 2.400 6.8e-08
aldosterone-producing adenoma -1.006 5.7e-03
subependymal giant cell astrocytoma 3.429 9.4e-03
lung carcinoma 4.000 9.8e-17
Pick disease -1.500 2.5e-03

Gene RIF (3)

PMID Text
26436652 CIP expression is reduced in patients with dilated cardiomyopathy.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of muscular LMNA-interacting protein (MLIP; C6orf142) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MELEKREKRSLLNKNLEEKLTVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPET      1 - 70
VNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDE     71 - 140
AASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKS    141 - 210
SYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHS    211 - 280
SDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEE    281 - 350
VYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFS    351 - 420
LSDEQENSHTLLSHNACNKLSHPMVAIPEHEALDSKEQ                                    421 - 458
//

Text Mined References (15)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26436652 2015 Cardiomyocyte-enriched protein CIP protects against pathophysiological stresses and regulates cardiac homeostasis.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21498514 2011 Identification of a novel muscle A-type lamin-interacting protein (MLIP).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218070 2002 T-cell variant of classical Hodgkin's lymphoma with nodal and cutaneous manifestations demonstrated by single-cell polymerase chain reaction.
11282395 2000 Normal V(D)J recombination in cells from patients with Nijmegen breakage syndrome.
11222402 2001 The diversity of rearranged immunoglobulin heavy chain variable region genes in peripheral blood B cells of preterm infants is restricted by short third complementarity-determining regions but not by limited gene segment usage.
11160357 2001 Psoriatic arthritis joint fluids are characterized by CD8 and CD4 T cell clonal expansions appear antigen driven.
10975868 2000 Coronary arteries from human cardiac allografts with chronic rejection contain oligoclonal T cells: persistence of identical clonally expanded TCR transcripts from the early post-transplantation period (endomyocardial biopsies) to chronic rejection (coronary arteries).