| Tbio | Homeobox protein Mohawk |
May act as a morphogenetic regulator of cell adhesion.
The protein encoded by this gene is an IRX family-related homeobox protein that may play a role in cell adhesion. Studies in mice suggest that this protein may be a regulator of tendon development. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Jun 2011]
The protein encoded by this gene is an IRX family-related homeobox protein that may play a role in cell adhesion. Studies in mice suggest that this protein may be a regulator of tendon development. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Jun 2011]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| posterior fossa group B ependymoma | 1530 | 2.8e-08 |
| glioblastoma | 5572 | 1.0e-06 |
| pediatric high grade glioma | 2712 | 7.8e-06 |
| pilocytic astrocytoma | 3086 | 1.7e-05 |
| pituitary cancer | 1972 | 2.1e-05 |
| primitive neuroectodermal tumor | 3031 | 8.1e-05 |
| medulloblastoma | 1524 | 8.8e-04 |
| medulloblastoma, large-cell | 6234 | 1.9e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| ulcerative colitis | 2087 | 0.0 | 1.0 |
| Disease | log2 FC | p |
|---|---|---|
| glioblastoma | -3.000 | 1.0e-06 |
| posterior fossa group B ependymoma | 2.400 | 2.8e-08 |
| medulloblastoma | -2.800 | 8.8e-04 |
| medulloblastoma, large-cell | -2.200 | 1.9e-02 |
| primitive neuroectodermal tumor | -2.700 | 8.1e-05 |
| pediatric high grade glioma | -2.300 | 7.8e-06 |
| pilocytic astrocytoma | -2.000 | 1.7e-05 |
| pituitary cancer | -3.400 | 2.1e-05 |
| PMID | Text | |
|---|---|---|
| 25332192 | these data shed light on previously unrecognized roles of Mkx in tendinopathy, tenogenesis, and tendon repair as well as in regulating the TGFbeta pathway. | |
| 25312837 | Transcription factor Mohawk controls tenogenic differentiation of bone marrow mesenchymal stem cells in vitro and in vivo. | |
| 23686683 | Reduced expression of MKX is a feature of degenerated anterior cruciate ligament in osteoarthritis-affected joints. | |
| 20634891 | Observational study of gene-disease association. (HuGE Navigator) | |
| 16077953 | In silico characterization of the C10orf48 sequence |
MNTIVFNKLSGAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGK 1 - 70 VRHKRQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWA 71 - 140 LRIKLYNKYVQGNAERLSVSSDDSCSEDGENPPRTHMNEGGYNTPVHHPVIKSENSVIKAGVRPESRASE 141 - 210 DYVAPPKYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYRTD 211 - 280 TLENGSNKGESAANRKGPSKDDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVPLVQ 281 - 350 QF 351 - 352 //
| PMID | Year | Title | |
|---|---|---|---|
| 25332192 | 2015 | Mohawk promotes the tenogenesis of mesenchymal stem cells through activation of the TGF? signaling pathway. | |
| 25312837 | 2015 | Transcription factor Mohawk controls tenogenic differentiation of bone marrow mesenchymal stem cells in vitro and in vivo. | |
| 23686683 | 2013 | Transcription factor Mohawk and the pathogenesis of human anterior cruciate ligament degradation. | |
| 22542470 | 2012 | Genome-wide association study of antibody response to smallpox vaccine. | |
| 20696843 | 2010 | The atypical homeodomain transcription factor Mohawk controls tendon morphogenesis. | |
| 20634891 | 2010 | Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia. | |
| 20498044 | 2010 | The Mohawk homeobox gene is a critical regulator of tendon differentiation. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. | |
| 16408284 | 2006 | Mohawk is a novel homeobox gene expressed in the developing mouse embryo. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 16077953 | 2005 | In silico characterization of an Iroquois family-related homeodomain protein. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15164054 | 2004 | The DNA sequence and comparative analysis of human chromosome 10. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 7829101 | 1994 | Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening. |
