Property Summary

NCBI Gene PubMed Count 15
PubMed Score 25.01
PubTator Score 8.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 1.1
Disease Target Count Z-score Confidence
Smallpox 19 3.013 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -2.000 1.9e-03
Astrocytoma, Pilocytic -2.200 1.3e-05
ependymoma 1.600 4.5e-03
glioblastoma -2.300 2.2e-08
group 3 medulloblastoma -2.100 8.0e-03
medulloblastoma, large-cell -2.200 1.9e-02
pituitary cancer -3.400 2.1e-05
primitive neuroectodermal tumor -2.700 8.1e-05

Gene RIF (5)

AA Sequence

MNTIVFNKLSGAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGK      1 - 70
VRHKRQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWA     71 - 140
LRIKLYNKYVQGNAERLSVSSDDSCSEDGENPPRTHMNEGGYNTPVHHPVIKSENSVIKAGVRPESRASE    141 - 210
DYVAPPKYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYRTD    211 - 280
TLENGSNKGESAANRKGPSKDDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVPLVQ    281 - 350
QF                                                                        351 - 352
//

Text Mined References (17)

PMID Year Title