Property Summary

NCBI Gene PubMed Count 15
PubMed Score 23.29
PubTator Score 8.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -3.000 1.0e-06
posterior fossa group B ependymoma 2.400 2.8e-08
medulloblastoma -2.800 8.8e-04
medulloblastoma, large-cell -2.200 1.9e-02
primitive neuroectodermal tumor -2.700 8.1e-05
pediatric high grade glioma -2.300 7.8e-06
pilocytic astrocytoma -2.000 1.7e-05
pituitary cancer -3.400 2.1e-05

Gene RIF (5)

PMID Text
25332192 these data shed light on previously unrecognized roles of Mkx in tendinopathy, tenogenesis, and tendon repair as well as in regulating the TGFbeta pathway.
25312837 Transcription factor Mohawk controls tenogenic differentiation of bone marrow mesenchymal stem cells in vitro and in vivo.
23686683 Reduced expression of MKX is a feature of degenerated anterior cruciate ligament in osteoarthritis-affected joints.
20634891 Observational study of gene-disease association. (HuGE Navigator)
16077953 In silico characterization of the C10orf48 sequence

AA Sequence

MNTIVFNKLSGAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGK      1 - 70
VRHKRQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWA     71 - 140
LRIKLYNKYVQGNAERLSVSSDDSCSEDGENPPRTHMNEGGYNTPVHHPVIKSENSVIKAGVRPESRASE    141 - 210
DYVAPPKYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYRTD    211 - 280
TLENGSNKGESAANRKGPSKDDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVPLVQ    281 - 350
QF                                                                        351 - 352
//

Text Mined References (17)

PMID Year Title
25332192 2015 Mohawk promotes the tenogenesis of mesenchymal stem cells through activation of the TGF? signaling pathway.
25312837 2015 Transcription factor Mohawk controls tenogenic differentiation of bone marrow mesenchymal stem cells in vitro and in vivo.
23686683 2013 Transcription factor Mohawk and the pathogenesis of human anterior cruciate ligament degradation.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
20696843 2010 The atypical homeodomain transcription factor Mohawk controls tendon morphogenesis.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20498044 2010 The Mohawk homeobox gene is a critical regulator of tendon differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16408284 2006 Mohawk is a novel homeobox gene expressed in the developing mouse embryo.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16077953 2005 In silico characterization of an Iroquois family-related homeodomain protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.