Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H1L0 Q2TB30
Symbols C20orf166
MIR133A2HG

Gene

 Compartment GO Term (1)

AA Sequence

MPSCSCALMAPCGPAAGPAAVERTQQVARGEPGSARGQLQVSPEMSITHKEKENAHLKEILLFVNAEAFS      1 - 70
QPQPHSAPVCEGQQLTGKFSTSVLTRAGGDASPCSWERLLCYGWSHC                            71 - 117
//

Text Mined References (6)

PMID Year Title