Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.46
PubTator Score 18.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 3.5e-03
ependymoma -1.400 2.7e-03
oligodendroglioma -1.400 8.6e-03
glioblastoma -1.800 9.8e-07
atypical teratoid / rhabdoid tumor -1.600 3.7e-09
medulloblastoma, large-cell -1.400 1.6e-04
primitive neuroectodermal tumor -1.100 3.7e-03
pediatric high grade glioma -1.500 8.1e-08
pilocytic astrocytoma -1.200 5.6e-10
subependymal giant cell astrocytoma -1.503 3.0e-02

Gene RIF (3)

PMID Text
23704930 APOOL is a cardiolipin-binding component of the Mitofilin/MINOS protein complex.
22114354 Proteomic analyses reveal MINOS1/Mio10 as a novel constituent of Mitofilin/Fcj1 complexes in human and yeast mitochondria
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG      1 - 70
KYVKEQEQ                                                                   71 - 78
//

Text Mined References (19)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25764979 2015 The non-glycosylated isoform of MIC26 is a constituent of the mammalian MICOS complex and promotes formation of crista junctions.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
24687277 2014 Uniform nomenclature for the mitochondrial contact site and cristae organizing system.
23704930 2013 APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22114354 2012 MINOS1 is a conserved component of mitofilin complexes and required for mitochondrial function and cristae organization.
21944719 2011 Dual role of mitofilin in mitochondrial membrane organization and protein biogenesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.