Property Summary

NCBI Gene PubMed Count 146
PubMed Score 0.00
PubTator Score 203.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.216 8.0e-03
esophageal adenocarcinoma 1.300 1.8e-02
cutaneous lupus erythematosus 2.900 1.2e-04
osteosarcoma -1.690 6.7e-03
glioblastoma 1.900 8.3e-04
tuberculosis 1.100 2.3e-07
intraductal papillary-mucinous neoplasm ... 2.500 9.2e-03
lung cancer -2.000 2.2e-03
breast carcinoma 1.100 3.6e-04
interstitial cystitis 2.000 1.9e-03
cystic fibrosis 1.700 4.6e-04
pediatric high grade glioma 2.000 1.0e-05
pilocytic astrocytoma 1.100 2.0e-03
posterior fossa group A ependymoma 1.200 2.3e-05
primary Sjogren syndrome 2.000 2.6e-04
lung carcinoma -1.200 1.8e-23
gastric carcinoma 1.700 2.5e-02
invasive ductal carcinoma 1.400 9.8e-03
ulcerative colitis 2.100 6.9e-05
ovarian cancer 1.700 8.7e-04
Breast cancer 1.600 1.9e-04
chronic rhinosinusitis 1.096 2.2e-02

Gene RIF (108)

PMID Text
26708143 Our results suggest that locally sustained expression of MICA and MICB in the tumor may contribute to the malignant progression of Gastric cancer(GC) and that expression of these ligands predicts an unfavorable prognosis in GC patients presenting large tumors.
26071561 Genotoxic stress induces senescence-associated ADAM10-dependent release of NKG2D MIC ligands (MICA, MICB) in multiple myeloma cells.
25990310 Aligned with MICB*005:02, MICB*030 has a nonsynonymous adenine substitution at nucleotide position 50 in exon 3, leading to amino acid change from serine to arginine at codon 102 of the mature MICB molecule.
25887583 We have demonstrated a novel mechanism by which tumor-derived sMIC may temper the immune reactive tumor microenvironment.
25775242 This study suggests that NKG2D ligands shedding of MICA, MICB and ULBP-2 is a novel pathway in endometriosis complex pathogenesis that impairs Natural Killer Cells cell function.
25626490 The sMICB serum levels were significantly increased in hepatitis B patients compared to healthy controls. The sMICB serum levels were decreased in a treated hepatocellular carcinoma (HCC) patient group compared to a not-treated HCC patient group.
25363527 Estrogen upregulates MICA/B expression in human non-small cell lung cancer through the regulation of ADAM17.
25228093 MICA/B expression is inhibited by unfolded protein response and associated with poor prognosis in human hepatocellular carcinoma.
25167773 Data indicate that MHC class I chain-related protein A (MICA)( *)010, MICA( *)A5 and MHC class I chain-related protein B (MICB)( *)005:02 were the most frequent alleles.
24997223 MICb expression in macrophage foam cells infiltrating atherosclerotic plaques
24973455 Experiments demonstrate that infection in vitro with human cytomegalovirus leads to enhanced shedding of MICA and MICB.
24962621 If differential expression by polymorphic MICA and MICB promoters is confirmed by functional studies, involvement of these genes in disease susceptibility or adverse transplantation outcomes may require knowledge of both promoter and allelic types to make meaningful conclusions.
24924487 six RNA-binding proteins that bind and regulate the expression of MICB.
24884822 we conclude that rs3132468-C at MICB and rs3765524-C at PLCE1 confer risk of DSS in Southeast Asians.
24869966 The elevation of soluble MICB during acute primary Dengue virus infections in infants likely represents an immune evasion strategy and contributes to the severity of the acute illness.
24173243 Poorly differentiated tumors showed high MICA/B expression, which was related to extended tumor lymph node metastases and less frequent long-term survival.
24058482 Broad MICA and MICB expression in the small bowel mucosa suggest a link between cellular stress and celiac disease.
24018560 Soluble and membrane-restricted NKG2D ligand, MICB, poses opposite impacts on prostate cancer progression.
23917076 Hepatitis B surface antigen inhibits MICA and MICB expression via induction of cellular miRNAs in hepatocellular carcinoma cells.
23625227 Diverse MICB alleles differentially bound cytomegalovirus UL16.
23549730 The frequencies of 20 MICB alleles and their haplotypes among 400 unrelated Han persons was determined. 5 new alleles, MICB*005:07, MICB*005:08, MICB*027, MICB*028, & MICB*029 were found.MICB*028 probably arose from MICB*004:01:01.
23536857 the MICB rs3132468 and PLCE1 rs3740360 genotypes are associated with clinically apparent dengue in both adults and children.
23527639 17beta-estradiol upon forming a complex with its cognate receptor suppresses MICB expression through binding with SP1/SP3 sites within the MICB promoter GC box.
23526433 study observed a substantial heterogeneity among the different cancer cell lines with regard to the involvement of ADAM10 and/or ADAM17 in MICA or MICB shedding
23291067 MICA and MICB were upregulated in esophageal cancer. The expression of MICA/B was related with histological grade.
22915757 our results define MICB as a novel immune target of miR-10b
22609444 Two new MICB alleles, MICB*005:06 and MICB*026, have been identified in a southern Chinese Han population.
22415659 The results showed that midkine expression in gastric tumor cells indirectly suppresses natural killer cytotoxicity by inducing MICA/B expression and suppressing NKG2D expression.
22301547 MICA and MICB molecules act as key ligands for activating receptor natural killer cell (NK) group 2, member D (NKG2D) and promote NK cell-mediated recognition and cytolysis.
22227571 data suggest that posttranslational N-linked glycosylation is strictly required for NKG2D ligand, MICB, surface expression
22221182 Expression of FimX produces bidirectional inversion of the hyxR promoter region and promotes HyxR expression. HyxR suppresses intracellular survival in macrophages through reactive nitrogen intermediate-dependent and -independent mechanisms.
22184268 high expression of MICB gene in Multiple sclerosis (MS) patients is an important criterion of MS disease that it may be due to the interaction between MICB and its receptor on CD8+T or NK cells.
22001756 identified a susceptibility locus at MICB (major histocompatibility complex (MHC) class I polypeptide-related sequence B), which was within the broad MHC region on chromosome 6 but outside the class I and class II HLA loci, per-allele odds ratio
21857986 Data show that VSV infection caused an active suppression of NKG2D-ligand surface expression, affecting both endogenous and histone deacetylase (HDAC)-inhibitor induced MICA, MICB and ULBP-2 expression.
21762746 Statistical analysis revealed a tendency for MICA*008 and MICB*008 to associate with susceptibility to illness when symptomatic versus asymptomatic cases of Dengue were compared.
21744989 Low MICB is associated with hepatocellular carcinoma.
21605422 The levels of MICB expression in serum and tissue of pancreatic cancer are elevated
21554252 Information about MICB allele frequencies and haplotypes with HLA in Koreans.
21518478 The positive expression rate of MHC-I A/B and HLA-E in ALL patients was obviously higher than that in AML patients.
21477352 tumor cells can simultaneously secrete MICA and MICB molecules and express their receptor, and be induced for proliferation by these stress molecules
21426309 As delivery approaches, the reduced production of soluble MICA/B by the aged placenta may be playing a role in parturition. Effect of soluble MICA/B on natural killer cells of pregnant women is limited to the maternal placental surface
21042760 Sodium valproate augments the expression of cell-surface NKG2D ligands, MICA/B, without increasing their soluble forms to enhance susceptibility of human osteosarcoma cells to NK cell-mediated cytotoxicity.
20662065 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20428196 Levels of soluble MICB were significantly increased in B-cell chronic lymphocytic leukemia.
20138739 These results provide initial clues to the importance of examining the impact of genetic variations(MICB) or environmental factors in the background of the other.
19949079 mutation of T14 and M82 in the adenovirus early transcription unit 3 selectively compromised MICA/B downregulation
19851445 Observational study of gene-disease association. (HuGE Navigator)
19691640 An association is reported between MICA and MICB in Alzheimer disease.
19691640 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19662431 MICB0106 allele was positively associated with ulcerative colitis in the Han Chinese population in central China.
19662431 Observational study of gene-disease association. (HuGE Navigator)
19553547 Growth supernatant from propionibacteria or propionate alone could directly stimulate functional MICA/B surface expression and MICA promoter activity by a mechanism dependent on intracellular calcium
19200602 CD14(+) monocytes promote NKG2D(+)CD4(+) T cells activation through the NKG2D-MIC engagement in the pathogenesis of systemic lupus erytematosus.
19147769 shedding of the immunostimulatory MHC class I chain-related gene B prevents tumor formation
19115949 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of MHC class I polypeptide-related sequence B (MICB) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
18791713 Expression of MICA/B was detected in 97.6 of ovarian cancer cells,but not on normal ovarian epithelium. The expression of MICA/B in ovarian cancer was highly correlated with that of ULBP2.
18785505 Observational study of gene-disease association. (HuGE Navigator)
18588574 MICB*004 allele frequency is significantly increased in multiple sclerosis patients.
18588574 Observational study of gene-disease association. (HuGE Navigator)
18505429 Observational study of gene-disease association. (HuGE Navigator)
18486757 Elevated soluble MICB levels exist in serum of multiple sclerosis patients related with disease activity.
18394338 As NKG2D ligand, MICB are expressed on immature dendritic cells and plays an important role in the cytotoxic effect of NK cells against iDC.
18332098 Common MICA and MICB genetic variations are not associated with susceptibility to type 1 diabetes.
18332098 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18287244 while infection with wild-type Ad enhances synthesis of the NKG2D ligands, MICA and MICB, their expression on the cell surface is actively suppressed.
17678727 study reports that the MICB 0050204(1) allele, present in the majority of the Spanish population (70% of healthy controls) is characterized by the presence of an extra exon found between the sequence corresponding to exon 1 and 2
17641203 study shows that human cytomegalovirus-miR-UL112 specifically down-regulates MICB expression during viral infection, leading to decreased binding of NKG2D and reduced killing by NK cells
17625602 upregulation of MICA and MICB by treatment with TsA leads to enhancement of the susceptibility of leukemic cells to the cytotoxicity of NKG2D-expressing cells
17584663 Data show that expression of NKG2D ligands MICA and MICB on CNE2 and CNE2/DDP cells is correlated with NK cell-mediated lysis.
17565371 study shows MICA & MICB, with exception of the central nervous system, is widely transcribed; data question previous assumptions, correlating a tissue-specific expression/induction of MIC in relevance to auto-immune or tumor processes
17561376 Observational study of gene-disease association. (HuGE Navigator)
17561376 MICB protein polymorphism is implicated in human herpes virus seropositivity and schizophrenia risk.
17557375 variations in MICB expression among normal individuals could imply a significant difference in the natural immune response against infections or tumor transformation
17202358 reveal distinct modes of activation of the genes for the MIC ligands of NKG2D and provide a molecular framework for analyses of gene regulation under different cellular insult conditions
17003176 Observational study of gene-disease association. (HuGE Navigator)
16923796 Observational study of gene-disease association. (HuGE Navigator)
16923796 In a study of mainly paucibacillary leprosy-affected sib-pair families from South India, we have identified significant association with a functional variant of the MICA gene as well as a microsatellite in the flanking region of the MICB gene.
16849432 NKG2D and MICB in the cytotoxic NK cell immune synapse have roles in NK cell cytotoxic function
16776673 Observational study of gene-disease association. (HuGE Navigator)
16698444 Observational study of gene-disease association. (HuGE Navigator)
16698444 MICB promoter polymorphism haplotypes showed strong linkage disequilibrium with MICB alleles.
16698441 MICB, the second member of the human MIC protein family, is likewise shed by metalloproteases from tumor cells and is present in sera of patients with gastrointestinal tumors.
16679067 Observational study of gene-disease association. (HuGE Navigator)
16679067 MICB-CA18 is positively associated with ulcerative colitis and female ulcerative colitis patients in a Chinese population.
16568261 Engagement of MIC by NKG2D promotes spontaneous HAM/TSP T cell proliferation and, apparently, CTL activities against HTLV-1-infected T cells.
16101831 Observational study of gene-disease association. (HuGE Navigator)
16101830 Observational study of gene-disease association. (HuGE Navigator)
15967992 analysis of human, chimpanzee and rhesus monkey MHC-B and MHC-C DNA gives insight to the time frame of human divergence from Old World monkeys
15640005 Observational study of genotype prevalence. (HuGE Navigator)
15304009 Observational study of genotype prevalence. (HuGE Navigator)
15304009 The polymorphisms and haplotype distributions of MICA and MICB microsatellite and HLA-B locus in the Guangzhou Han population have their own distinct genetic characteristics
15304008 eight novel MICB variants, including a null allele, which were identified in peripheral blood leukocytes of gastric MALT lymphoma patients.
15192843 Observational study of genotype prevalence. (HuGE Navigator)
15191526 new allele is identical to MICB-0103101v except for a single mutation of G to A in exon 4 that translates into an amino acid substitution from glutamic acid to lysine
14662896 Circulating soluble MICB in cancer patients deactivates natural killer (NK) cell-mediated NK immunity by down-modulating important activating and chemokine receptors in vitro and in vivo.
12714493 Determination of sMICA and sMICB levels may be implemented as a prognostic parameter in patients with hematopoietic malignancies.
12569559 micb, overexpressed on a subset of human HCCs, may play an important role in their susceptibility to NK cells.
12538683 MICB is induced on dendritic cells upon IFN-alpha stimulation and is capable of activating NK cells by a mechanism that is impaired in hepatitis C virus infection.
12466900 Alternatively spliced forms of MICA and MICB lacking exon 3 in a human cell line and evidence of presence of similar RNA in human peripheral blood mononuclear cells
12392511 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12384702 binding of MICA and MICB induces endocytosis and downregulation of NKG2D, and in turn severe impairment of the responsiveness of tumour-antigen-specific effector T cells
12242594 high frequency of the MIC null haplotype, HLA-B48-MICA-del-MICB*0107 N, in the Angaite Amerindian community in Paraguay
12022360 Observational study of gene-disease association. (HuGE Navigator)
11881819 From pairwise associations in the random panel and results for the homozygous cell lines it was possible to deduce the MICA and MICB microsatellite alleles present in many of the well-known Caucasoid
11862397 Observational study of genotype prevalence. (HuGE Navigator)
11862397 an Alu repeat dimorphism within the first intron of the MICB gene was found
11169252 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQG      1 - 70
QWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELF     71 - 140
LSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVN    141 - 210
VTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRF    211 - 280
TCYMEHSGNHGTHPVPSGKVLVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLD    281 - 350
QHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA                                         351 - 383
//

Text Mined References (150)

PMID Year Title
26708143 2016 Clinical significance of tumor expression of major histocompatibility complex class I-related chains A and B (MICA/B) in gastric cancer patients.
26071561 2015 Genotoxic Stress Induces Senescence-Associated ADAM10-Dependent Release of NKG2D MIC Ligands in Multiple Myeloma Cells.
25990310 2015 Identification of a novel MICB allele, MICB*030, by cloning and sequencing.
25887583 2015 Soluble NKG2D ligand promotes MDSC expansion and skews macrophage to the alternatively activated phenotype.
25775242 2015 Soluble ligands for the NKG2D receptor are released during endometriosis and correlate with disease severity.
25626490 2015 Soluble MICB protein levels and platelet counts during hepatitis B virus infection and response to hepatocellular carcinoma treatment.
25363527 2015 Estrogen upregulates MICA/B expression in human non-small cell lung cancer through the regulation of ADAM17.
25228093 2014 MICA/B expression is inhibited by unfolded protein response and associated with poor prognosis in human hepatocellular carcinoma.
25167773 2014 MIC gene polymorphism and haplotype diversity in Zhuang nationality of Southern China.
24997223 2014 MICA/B expression in macrophage foam cells infiltrating atherosclerotic plaques.
24973455 2014 Altered microRNA expression after infection with human cytomegalovirus leads to TIMP3 downregulation and increased shedding of metalloprotease substrates, including MICA.
24962621 2014 Diversity and characterization of polymorphic 5' promoter haplotypes of MICA and MICB genes.
24924487 2014 RNA-binding proteins regulate the expression of the immune activating ligand MICB.
24884822 2014 A replication study confirms the association of GWAS-identified SNPs at MICB and PLCE1 in Thai patients with dengue shock syndrome.
24869966 2014 Circulating levels of soluble MICB in infants with symptomatic primary dengue virus infections.
24173243 2014 Expression of major histocompatibility complex class I-related chain A/B (MICA/B) in pancreatic carcinoma.
24132900 2013 Genome-wide association study of atypical psychosis.
24058482 2013 Broad MICA/B expression in the small bowel mucosa: a link between cellular stress and celiac disease.
24018560 2013 Perturbation of NK cell peripheral homeostasis accelerates prostate carcinoma metastasis.
23917076 2014 Hepatitis B surface antigen inhibits MICA and MICB expression via induction of cellular miRNAs in hepatocellular carcinoma cells.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23625227 2013 Allelic MHC class I chain related B (MICB) molecules affect the binding to the human cytomegalovirus (HCMV) unique long 16 (UL16) protein: implications for immune surveillance.
23549730 2013 Distribution of MICB diversity in the Zhejiang Han population: PCR sequence-based typing for exons 2-6 and identification of five novel MICB alleles.
23536857 2013 Genetic variants of MICB and PLCE1 and associations with non-severe dengue.
23527639 2013 17?-Estradiol suppresses MHC class I chain-related B gene expression via an intact GC box.
23526433 2013 Shedding of endogenous MHC class I-related chain molecules A and B from different human tumor entities: heterogeneous involvement of the "a disintegrin and metalloproteases" 10 and 17.
23479551 2013 Metastamir-mediated immune evasion: miR-10b downregulates the stress-induced molecule MICB, hence avoid recognition by NKG2D receptor.
23380144 2013 Characterization of 3'untranslated region (3'UTR) of the MICB gene.
23314034 2013 ADAM15 is involved in MICB shedding and mediates the effects of gemcitabine on MICB shedding in PANC-1 pancreatic cancer cells.
23291067 2012 [Expression of MICA/B protein in esophageal cancer and its clinical significance].
23150178 2013 Serum soluble MICB (sMICB) correlates with disease progression and survival in melanoma patients.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23001997 2012 Identification of a susceptibility locus in STAT4 for Behçet's disease in Han Chinese in a genome-wide association study.
22915757 2012 MiR-10b downregulates the stress-induced cell surface molecule MICB, a critical ligand for cancer cell recognition by natural killer cells.
22609444 2012 MICB polymorphism in a southern Chinese Han population: the identification of two new MICB alleles, MICB*005:06 and MICB*026.
22415659 2012 Midkine upregulates MICA/B expression in human gastric cancer cells and decreases natural killer cell cytotoxicity.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
22301547 2012 HER2/HER3 signaling regulates NK cell-mediated cytotoxicity via MHC class I chain-related molecule A and B expression in human breast cancer cell lines.
22286212 2012 Genome-wide association study of classical Hodgkin lymphoma and Epstein-Barr virus status-defined subgroups.
22227571 2012 2-deoxy D-glucose prevents cell surface expression of NKG2D ligands through inhibition of N-linked glycosylation.
22221182 2012 Epigenetic regulation of the nitrosative stress response and intracellular macrophage survival by extraintestinal pathogenic Escherichia coli.
22184268 2011 MICB gene expression on peripheral blood mononuclear cells and susceptibility to multiple sclerosis in north of Iran.
22102813 2011 The human herpesvirus-7 (HHV-7) U21 immunoevasin subverts NK-mediated cytoxicity through modulation of MICA and MICB.
22001756 2011 Genome-wide association study identifies susceptibility loci for dengue shock syndrome at MICB and PLCE1.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21857986 2011 Vesicular stomatitis virus infection promotes immune evasion by preventing NKG2D-ligand surface expression.
21762746 2011 Association of MICA and MICB alleles with symptomatic dengue infection.
21744989 2011 Expression of the nonclassical HLA class I?and MICA/B molecules in human hepatocellular carcinoma.
21664939 2011 Characterization of the major histocompatibility complex class I chain-related gene B (MICB) polymorphism in a northern Chinese Han population: the identification of a new MICB allele, MICB*023.
21605422 2011 Major histocompatibility complex class I-related chain A/B (MICA/B) expression in tumor tissue and serum of pancreatic cancer: role of uric acid accumulation in gemcitabine-induced MICA/B expression.
21554252 2011 MICB polymorphisms and haplotypes with MICA and HLA alleles in Koreans.
21518478 2011 [Expression of NKG2D and NKG2A with their ligands MHC-I A/B and HLA-E in acute leukemia patients and its significance].
21477352 2011 Expression of MICA, MICB and NKG2D in human leukemic myelomonocytic and cervical cancer cells.
21426309 2011 The alteration of placental-derived soluble MHC class I chain-related protein A and B during pregnancy.
21388352 2011 Impact of MICA-TM, MICB-C1_2_A and C1_4_1 microsatellite polymorphisms on the susceptibility to chronic periodontitis in Germany.
21042760 2010 Sodium valproate, a histone deacetylase inhibitor, augments the expression of cell-surface NKG2D ligands, MICA/B, without increasing their soluble forms to enhance susceptibility of human osteosarcoma cells to NK cell-mediated cytotoxicity.
21036725 2010 Soluble MICB serum levels correlate with disease stage and survival rate in patients with oral squamous cell carcinoma.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
20566410 2010 HIF-1alpha accumulation upregulates MICA and MICB expression on human cardiomyocytes and enhances NK cell cytotoxicity during hypoxia-reoxygenation.
20428196 2010 The prognostic significance of soluble NKG2D ligands in B-cell chronic lymphocytic leukemia.
20138739 2010 Grey matter changes associated with host genetic variation and exposure to Herpes Simplex Virus 1 (HSV1) in first episode schizophrenia.
19949079 2010 Conserved amino acids within the adenovirus 2 E3/19K protein differentially affect downregulation of MHC class I and MICA/B proteins.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19691640 2009 Association study of MICA and MICB in Alzheimer's disease.
19662431 2010 MICB0106 gene polymorphism is associated with ulcerative colitis in central China.
19553547 2009 Propionic acid secreted from propionibacteria induces NKG2D ligand expression on human-activated T lymphocytes and cancer cells.
19380116 2009 Diverse herpesvirus microRNAs target the stress-induced immune ligand MICB to escape recognition by natural killer cells.
19353249 2009 Association of MICA-TM and MICB C1_2_A microsatellite polymorphisms with tumor progression in patients with colorectal cancer.
19200602 2009 Mutual activation of CD4+ T cells and monocytes mediated by NKG2D-MIC interaction requires IFN-gamma production in systemic lupus erythematosus.
19147769 2009 Obstructing shedding of the immunostimulatory MHC class I chain-related gene B prevents tumor formation.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
18791713 2009 Clinical significance of the NKG2D ligands, MICA/B and ULBP2 in ovarian cancer: high expression of ULBP2 is an indicator of poor prognosis.
18785505 2008 [An association between MICB 0106 allele and ulcerative colitis in Chinese Han in Hubei province].
18644891 2008 Decreased Dicer expression elicits DNA damage and up-regulation of MICA and MICB.
18588574 2008 Genetic influence of the nonclassical major histocompatibility complex class I molecule MICB in multiple sclerosis susceptibility.
18505429 2008 Associations of MICB with cervical cancer in north-eastern Thais: identification of major histocompatibility complex class I chain-related gene B motifs influencing natural killer cell activation.
18486757 Soluble MHC class I chain-related protein B serum levels correlate with disease activity in relapsing-remitting multiple sclerosis.
18395517 2008 Induction of MHC class I-related chain B (MICB) by 5-aza-2'-deoxycytidine.
18394338 2008 [Expression of NKG2D ligands on dendritic cells at different development stages and its effect on cytotoxicity of NK cells].
18332098 2008 Sequencing-based genotyping and association analysis of the MICA and MICB genes in type 1 diabetes.
18287244 2008 Adenovirus E3/19K promotes evasion of NK cell recognition by intracellular sequestration of the NKG2D ligands major histocompatibility complex class I chain-related proteins A and B.
17678727 2007 The allele MICB 0050204, over-represented in the Caucasian population, has an additional exon resulting from a new splice junction sequence.
17641203 2007 Host immune system gene targeting by a viral miRNA.
17625602 2007 Regulation of the expression of MHC class I-related chain A, B (MICA, MICB) via chromatin remodeling and its impact on the susceptibility of leukemic cells to the cytotoxicity of NKG2D-expressing cells.
17584663 2007 [Expression of NKG2D ligands in multidrug-resistant nasopharyngeal carcinoma cell line CNE2/DDP and their effects on cytotoxicity of natural killer cells].
17565371 2007 In vivo expression pattern of MICA and MICB and its relevance to auto-immunity and cancer.
17561376 2007 Polymorphisms in MICB are associated with human herpes virus seropositivity and schizophrenia risk.
17557375 2007 Transcriptional regulation of MICA and MICB: a novel polymorphism in MICB promoter alters transcriptional regulation by Sp1.
17202358 2007 Promoter region architecture and transcriptional regulation of the genes for the MHC class I-related chain A and B ligands of NKG2D.
17003176 2007 MHC class I chain-related gene B (MICB) is associated with rheumatoid arthritis susceptibility.
16923796 2006 Variation in MICA and MICB genes and enhanced susceptibility to paucibacillary leprosy in South India.
16849432 2006 Transfer of NKG2D and MICB at the cytotoxic NK cell immune synapse correlates with a reduction in NK cell cytotoxic function.
16776673 2006 AluyMICB dimorphism within the class I region of the major histocompatibility complex is associated with asthma and airflow obstruction in the Busselton population.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16698444 2006 MHC class I chain-related gene B promoter polymorphisms and celiac disease.
16698441 2006 Release of MICB molecules by tumor cells: mechanism and soluble MICB in sera of cancer patients.
16679067 2006 MICB microsatellite polymorphism is associated with ulcerative colitis in Chinese population.
16568261 2006 Immunostimulation by induced expression of NKG2D and its MIC ligands in HTLV-1-associated neurologic disease.
16101831 2005 The haplotype block, NFKBIL1-ATP6V1G2-BAT1-MICB-MICA, within the class III-class I boundary region of the human major histocompatibility complex may control susceptibility to hepatitis C virus-associated dilated cardiomyopathy.
16101830 2005 Associations of major histocompatibility complex class I chain-related molecule polymorphisms with Behcet's disease in Caucasian patients.
15967992 2005 Genomic evolution of MHC class I region in primates.
15640005 2004 [The study on the haplotype of MICA and MICB microsatellite locus in Guangzhou Han population].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304009 2004 Study on the haplotypes of MICA and MICB microsatellite and HLA-B locus in the Guangzhou Han population.
15304008 2004 Eight novel MICB alleles, including a null allele, identified in gastric MALT lymphoma patients.
15192843 2004 [The polymorphism distributions of MICA and MICB microsatellite in Guangdong Han population].
15191526 2004 A novel major histocompatibility complex class I-related chain allele.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14662896 2003 Evasion from NK cell immunity by MHC class I chain-related molecules expressing colon adenocarcinoma.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12902493 2003 Potential role of NKG2D/MHC class I-related chain A interaction in intrathymic maturation of single-positive CD8 T cells.
12782710 2003 Human cytomegalovirus glycoprotein UL16 causes intracellular sequestration of NKG2D ligands, protecting against natural killer cell cytotoxicity.
12714493 2003 Functional expression and release of ligands for the activating immunoreceptor NKG2D in leukemia.
12682252 2003 Intracellular retention of the MHC class I-related chain B ligand of NKG2D by the human cytomegalovirus UL16 glycoprotein.
12594848 2003 Selective intracellular retention of virally induced NKG2D ligands by the human cytomegalovirus UL16 glycoprotein.
12569559 2003 Expression and role of MICA and MICB in human hepatocellular carcinomas and their regulation by retinoic acid.
12538683 2003 Critical role of MHC class I-related chain A and B expression on IFN-alpha-stimulated dendritic cells in NK cell activation: impairment in chronic hepatitis C virus infection.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466900 2002 Alternatively spliced forms of MICA and MICB lacking exon 3 in a human cell line and evidence of presence of similar RNA in human peripheral blood mononuclear cells.
12392511 2002 High resolution MIC genotyping: design and application to the investigation of inflammatory bowel disease susceptibility.
12384702 2002 Tumour-derived soluble MIC ligands impair expression of NKG2D and T-cell activation.
12242594 2002 High frequency of MIC null haplotype (HLA-B48-MICA-del-MICB*0107 N) in the Angaite Amerindian community in Paraguay.
12133964 2002 Structural studies of allelic diversity of the MHC class I homolog MIC-B, a stress-inducible ligand for the activating immunoreceptor NKG2D.
12022360 2002 MICA rather than MICB, TNFA, or HLA-DRB1 is associated with susceptibility to psoriatic arthritis.
11881819 2001 MICA and MICB microsatellite alleles in HLA extended haplotypes.
11858820 2002 Structure and function of major histocompatibility complex (MHC) class I specific receptors expressed on human natural killer (NK) cells.
11777960 2002 UL16-binding proteins, novel MHC class I-related proteins, bind to NKG2D and activate multiple signaling pathways in primary NK cells.
11491531 Interactions of human NKG2D with its ligands MICA, MICB, and homologs of the mouse RAE-1 protein family.
11287116 2001 Oxidative stress increases MICA and MICB gene expression in the human colon carcinoma cell line (CaCo-2).
11239445 2001 ULBPs, novel MHC class I-related molecules, bind to CMV glycoprotein UL16 and stimulate NK cytotoxicity through the NKG2D receptor.
11169252 2001 Wide distribution of the MICA-MICB null haplotype in East Asians.
10894171 2000 Retinoic acid early inducible genes define a ligand family for the activating NKG2D receptor in mice.
10746790 2000 Three novel MICB alleles.
10691930 2000 PERB11 (MIC): a polymorphic MHC gene is expressed in skin and single nucleotide polymorphisms are associated with psoriasis.
10359807 1999 Broad tumor-associated expression and recognition by tumor-derived gamma delta T cells of MICA and MICB.
10047540 1999 Functions of nonclassical MHC and non-MHC-encoded class I molecules.
9770516 1998 Diversification, expression, and gamma delta T cell recognition of evolutionarily distant members of the MIC family of major histocompatibility complex class I-related molecules.
9694358 1998 Sequencing-based typing reveals six novel MHC class I chain-related gene B (MICB) alleles.
9497295 1998 Recognition of stress-induced MHC molecules by intestinal epithelial gammadelta T cells.
9321430 1997 Allelic variants of the human MHC class I chain-related B gene (MICB).
9271635 1997 Allelic repertoire of the human MICB gene.
8995188 1997 Allelic and interlocus comparison of the PERB11 multigene family in the MHC.
8952966 1996 Genomic structure of the human MHC class I MICB gene.
8901601 1996 Cell stress-regulated human major histocompatibility complex class I gene expressed in gastrointestinal epithelium.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8824804 1996 Genes in a 220-kb region spanning the TNF cluster in human MHC.
8575823 1996 Nucleotide sequence of a human MHC class I MICB cDNA.
8022771 1994 A second lineage of mammalian major histocompatibility complex class I genes.
7927538 1994 A new polymorphic and multicopy MHC gene family related to nonmammalian class I.