Property Summary

NCBI Gene PubMed Count 30
PubMed Score 12.88
PubTator Score 2268.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 3.400 8.9e-05
gastric cancer 1.400 7.5e-04
hepatocellular carcinoma 1.200 7.2e-06
pancreatic cancer 1.400 1.2e-03
osteosarcoma 2.516 5.9e-07
posterior fossa group B ependymoma 1.200 3.5e-05
group 4 medulloblastoma 1.900 9.2e-05
atypical teratoid/rhabdoid tumor 1.300 2.7e-05
glioblastoma -1.400 5.6e-03
medulloblastoma, large-cell 1.700 1.2e-04
autosomal dominant Emery-Dreifuss muscul... 1.077 6.1e-03
juvenile dermatomyositis 1.336 1.7e-09
Amyotrophic Lateral Sclerosis 1.293 8.1e-06
acute quadriplegic myopathy 1.787 1.9e-06
primary pancreatic ductal adenocarcinoma 1.352 2.5e-03
non-small cell lung cancer 1.424 7.2e-14
active Crohn's disease 1.242 2.1e-02
diabetes mellitus -1.300 3.4e-03
pancreatic carcinoma 1.400 1.2e-03
Pick disease 1.900 1.8e-05
acute myeloid leukemia -2.200 3.9e-02
ovarian cancer -3.100 1.7e-07

Protein-protein Interaction (2)

Gene RIF (16)

PMID Text
26204652 Expression of MIB1 ligase protein, human was correlated with tumor grade and Figo stages.
25795303 these results identify the interaction between Mib1 and Plk4 as a new and important element in the control of centriole homeostasis.
25747658 Data show how E3 ubiquitin protein ligase Mind bomb protein recognizes notch receptor ligands.
25319982 a significant survival benefit for p16-positive vaginal cancers compared with p16-negative cancers for stages I and II. No difference was observed in survival for MIB-1-positive tumors
25077370 This is the first published study ever assessing the expression of COX-2, p16 and Ki67 markers in ductal carcinoma in situ breast tumors.
24008756 Invasive adenomas have a higher inducible nitric oxide synthase, and this correlated with the MIB-1
23615451 Data show that the E3 ubiquitin ligase, mind bomb 1 (Mib1), interacts with and ubiquitinates SMN and facilitates its degradation.
23442362 MIB-1 was found to be associated with estrogen receptors in the stromal component
23314057 implicate NOTCH signaling in left ventricular noncompaction and indicate that MIB1 mutations arrest chamber myocardium development, preventing trabecular maturation and compaction
22184009 MIB1 negatively regulates TNFalpha- and IL1beta-induced NF-kappaB target gene activation
21875946 RYK interacts both physically and functionally with the E3 ubiquitin MIB1. MIB1 is sufficient to activate Wnt/CTNNB1 signaling and this activity depends on endogenous RYK.
20018188 Data demonstrate that c-mip interacts with Dip1 and upregulates DAPK, which blocks the nuclear translocation of ERK1/2.
19710364 The interaction between Mib1 and cFLIP decreases the association of caspase-8 with cFLIP, which activates caspase-8 and induces cell death
17390041 Comparative genomic hybridization and immunohistochemical assessment of EGFR, PTEN, p53, and MIB-1 expression in 13 oligodendrogliomas, one oligoastrocytoma and 23 high-grade astrocytomas is reported.
17324930 DAPK is found in two distinct immune complexes, one containing HSP90 and CHIP and a second complex containing only DIP1/Mib; strict modulation of DAPK activities by HSP90 heterocomplexes is critical for regulation of apoptosis and cellular homeostasis
17003037 Neuralized-2 regulates a Notch ligand in cooperation with Mind bomb-1

AA Sequence

MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRI      1 - 70
LDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESR     71 - 140
RKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFE    141 - 210
GMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLT    211 - 280
TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKL    281 - 350
LQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK    351 - 420
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDV    421 - 490
EAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQD    491 - 560
SEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKD    561 - 630
DGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGD    631 - 700
TPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRN    701 - 770
KKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC    771 - 840
SLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCRAVVERRVPF    841 - 910
IMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHG    911 - 980
TCQLCGDRMSECPICRKAIERRILLY                                                981 - 1006
//

Text Mined References (34)

PMID Year Title
26204652 THE PROGNOSTIC SIGNIFICANCE OF P53, BCL2 AND MIB1 EXPRESSIONS RELATED WITH OTHER CLINICOPATHOLOGICAL VARIABLES IN SEROUS OVARIAN CARCINOMAS. A CLINICOPATHOLOGICAL STUDY IN PERITONEAL FLUIDS.
25795303 2015 The E3 ubiquitin ligase Mib1 regulates Plk4 and centriole biogenesis.
25747658 2015 A tail of two sites: a bipartite mechanism for recognition of notch ligands by mind bomb E3 ligases.
25319982 2014 Improved survival in p16-positive vaginal cancers across all tumor stages but no correlation with MIB-1.
25077370 2014 COX-2, p16 and Ki67 expression in DCIS, microinvasive and early invasive breast carcinoma with extensive intraductal component.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121310 2013 A new cellular stress response that triggers centriolar satellite reorganization and ciliogenesis.
24008756 2014 The clinical and pathological significance of nitric oxide synthase in human pituitary adenomas: a comparison with MIB-1.
23615451 2013 The E3 ubiquitin ligase mind bomb 1 ubiquitinates and promotes the degradation of survival of motor neuron protein.
23478405 2013 The ubiquitin ligase Mindbomb 1 coordinates gastrointestinal secretory cell maturation.
23442362 ER, p53 and MIB-1 are significantly associated with malignant phyllodes tumor.
23314057 2013 Mutations in the NOTCH pathway regulator MIB1 cause left ventricular noncompaction cardiomyopathy.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22184009 2012 The E3 ubiquitin ligase MIB1 negatively regulates basal I?B? level and modulates NF-?B activation.
21948523 2011 Post-transcriptional exon shuffling events in humans can be evolutionarily conserved and abundant.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21896478 2011 The E3 ubiquitin ligase mind bomb-2 (MIB2) protein controls B-cell CLL/lymphoma 10 (BCL10)-dependent NF-?B activation.
21875946 2011 Mindbomb 1, an E3 ubiquitin ligase, forms a complex with RYK to activate Wnt/?-catenin signaling.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20720151 2010 Control of Notch-ligand endocytosis by ligand-receptor interaction.
20018188 2010 C-mip interacts with the p85 subunit of PI3 kinase and exerts a dual effect on ERK signaling via the recruitment of Dip1 and DAP kinase.
19710364 2009 Mind bomb 1 regulation of cFLIP interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17324930 2007 Regulation of death-associated protein kinase. Stabilization by HSP90 heterocomplexes.
17003037 2006 Neuralized-2 regulates a Notch ligand in cooperation with Mind bomb-1.
16857196 2006 Snx5, as a Mind bomb-binding protein, is expressed in hematopoietic and endothelial precursor cells in zebrafish.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15048887 2004 Death-associated protein kinase expression in human temporal lobe epilepsy.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12530964 2003 Mind bomb is a ubiquitin ligase that is essential for efficient activation of Notch signaling by Delta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351649 2002 A death-associated protein kinase (DAPK)-interacting protein, DIP-1, is an E3 ubiquitin ligase that promotes tumor necrosis factor-induced apoptosis and regulates the cellular levels of DAPK.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.