Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.36
PubTator Score 8.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.2e-08
psoriasis 6694 2.4e-04
breast carcinoma 1638 3.7e-04
osteosarcoma 7950 7.9e-04
astrocytoma 1146 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Prion disease 16 3.424 1.7
Congenital heart disease 93 3.372 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.100 3.7e-02
breast carcinoma 1.200 3.7e-04
osteosarcoma -1.152 7.9e-04
ovarian cancer -1.100 3.2e-08
psoriasis -1.700 2.4e-04

Protein-protein Interaction (8)

Gene RIF (10)

AA Sequence

MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQF      1 - 70
PYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASE     71 - 140
EFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDV    141 - 210
VEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVV    211 - 280
CLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLE    281 - 350
HDEHSCPFKKSKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGIS    351 - 420
DGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRES    421 - 490
SSPESFITEEVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPALGPDSCSVGIDE            491 - 552
//

Text Mined References (30)

PMID Year Title