Property Summary

NCBI Gene PubMed Count 28
PubMed Score 15.81
PubTator Score 83.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 3.300 3.8e-08
posterior fossa group B ependymoma -2.000 1.3e-13
osteosarcoma -2.673 3.4e-08
glioblastoma -2.100 1.1e-06
medulloblastoma -1.600 4.9e-07
atypical teratoid / rhabdoid tumor -2.100 1.8e-11
medulloblastoma, large-cell -2.000 6.2e-07
primitive neuroectodermal tumor -1.100 1.2e-02
intraductal papillary-mucinous carcinoma... 1.100 5.5e-03
lung cancer -1.600 6.8e-04
breast carcinoma -1.200 1.1e-03
adult high grade glioma -2.000 3.5e-08
lung adenocarcinoma -3.600 9.9e-23
pituitary cancer 1.100 7.8e-06
psoriasis -1.100 1.5e-42

Gene RIF (14)

PMID Text
26801611 High expression of alpha2,6-sialylation on the cell surface could affect the anti-migratory role of GnT-III, which provides an insight into the mechanistic roles of GnT-III in tumor metastasis.
26109616 Mgat3 plays an important role in early spontaneous miscarriage in humans.
26098720 MGAT3 protein and gene expression in in uveal and cutaneous melanoma cells
25936519 HS5 cells had significantly enhanced levels of bisecting N-glycans (catalyzed by MGAT3 whereas HS27a cells had enhanced levels of Galbeta1,4GlcNAc.
24726881 functional characterization of N-acetylglucosaminyltransferases III and V in human melanoma cells
23671930 GnT-III determines E-cadherin-mediated tumor suppression, and GnT-V regulates E-cadherin-mediated tumor invasion.
22451656 Roles of N-acetylglucosaminyltransferase III in epithelial-to-mesenchymal transition induced by transforming growth factor beta1 (TGF-beta1) in epithelial cell lines
21368380 MGAT3 mRNA biomarker may characterize subgroups of Alzheimer's disease patients with different disease progression.
20089585 the modulation of glycosyltransferases MGAT3 and MGAT5 by synthetic N-acetyl-D-glucosamine-calix[4]arene correlated with the improvement of NK cell effector functions and the augmentation of tumor cells sensitivity to NK cell-mediated cytotoxicity.
19776078 upregulation of GnT-III in AD brains may represent an adaptive response to protect them from additional beta-amyloid production
19403558 MGAT3 and MGAT5 competitively modified E-cadherin N-glycans.
19276077 An N-glycosylation site on the beta-propeller domain of the integrin alpha5 subunit plays key roles in both its function and site-specific modification by beta1,4-N-acetylglucosaminyltransferase III.
14998999 beta1,4-N-acetylglucosaminyltransferase III inhibits the function of alpha5beta1 integrin
12427758 down-regulation of hydrogen peroxide-induced PKC delta activation in cells transfected with this enzyme

AA Sequence

MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQASPEPGGPDLL      1 - 70
RTPLYSHSPLLQPLPPSKAAEELHRVDLVLPEDTTEYFVRTKAGGVCFKPGTKMLERPPPGRPEEKPEGA     71 - 140
NGSSARRPPRYLLSARERTGGRGARRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVIN    141 - 210
AINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPG    211 - 280
GRQDGWIADDYLRTFLTQDGVSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYG    281 - 350
FFWKQPGTLEVVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCS    351 - 420
WCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKN    421 - 490
YDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV                               491 - 533
//

Text Mined References (28)

PMID Year Title
26801611 2016 Expression of N-Acetylglucosaminyltransferase III Suppresses ?2,3-Sialylation, and Its Distinctive Functions in Cell Migration Are Attributed to ?2,6-Sialylation Levels.
26109616 2015 Altered ?1,6-GlcNAc and bisecting GlcNAc-branched N-glycan on integrin ?1 are associated with early spontaneous miscarriage in humans.
26098720 2015 Diverse expression of N-acetylglucosaminyltransferase V and complex-type ?1,6-branched N-glycans in uveal and cutaneous melanoma cells.
25936519 2015 Quantitative analysis of glycans, related genes, and proteins in two human bone marrow stromal cell lines using an integrated strategy.
24726881 2014 Overexpression of N-acetylglucosaminyltransferases III and V in human melanoma cells. Implications for MCAM N-glycosylation.
23671930 2013 E-cadherin and adherens-junctions stability in gastric carcinoma: functional implications of glycosyltransferases involving N-glycan branching biosynthesis, N-acetylglucosaminyltransferases III and V.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22451656 2012 Roles of N-acetylglucosaminyltransferase III in epithelial-to-mesenchymal transition induced by transforming growth factor ?1 (TGF-?1) in epithelial cell lines.
21368380 2011 MGAT3 mRNA: a biomarker for prognosis and therapy of Alzheimer's disease by vitamin D and curcuminoids.
20089585 2010 Glycosylation regulates NK cell-mediated effector function through PI3K pathway.
19776078 2010 Protective effect of N-glycan bisecting GlcNAc residues on beta-amyloid production in Alzheimer's disease.
19403558 2009 The role of N-acetylglucosaminyltransferase III and V in the post-transcriptional modifications of E-cadherin.
19276077 2009 An N-glycosylation site on the beta-propeller domain of the integrin alpha5 subunit plays key roles in both its function and site-specific modification by beta1,4-N-acetylglucosaminyltransferase III.
17652175 2007 Innate immunity and transcription of MGAT-III and Toll-like receptors in Alzheimer's disease patients are improved by bisdemethoxycurcumin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14998999 2004 Introduction of bisecting GlcNAc into integrin alpha5beta1 reduces ligand binding and down-regulates cell adhesion and cell migration.
12716887 2003 Caveolin-1 regulates the functional localization of N-acetylglucosaminyltransferase III within the golgi apparatus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427758 2003 Down-regulation of hydrogen peroxide-induced PKC delta activation in N-acetylglucosaminyltransferase III-transfected HeLaS3 cells.
11768033 2001 Expression of bisecting N-acetylglucosaminyltransferase-III in human hepatocarcinoma tissues, fetal liver tissues, and hepatoma cell lines of Hep3B and HepG2.
11011143 2000 Kinetic basis for the donor nucleotide-sugar specificity of beta1, 4-N-acetylglucosaminyltransferase III.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8706690 1996 Human N-acetylglucosaminyltransferase III gene is transcribed from multiple promoters.
8666260 1996 Sequence analysis of the 5'-flanking region of the gene encoding human N-acetylglucosaminyltransferase III.
8370666 1993 cDNA cloning, expression, and chromosomal localization of human N-acetylglucosaminyltransferase III (GnT-III).