Property Summary

NCBI Gene PubMed Count 25
PubMed Score 27956.43
PubTator Score 81.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 2.200 6.0e-03
nephrosclerosis -1.727 4.8e-02
malignant mesothelioma -7.600 1.9e-09
osteosarcoma -5.545 6.2e-05
cystic fibrosis -1.790 6.6e-05
tuberculosis and treatment for 6 months -2.000 4.7e-04
non-small cell lung carcinoma -1.200 1.7e-15
lung cancer -3.200 2.3e-06
lung adenocarcinoma -1.200 3.1e-09
lung carcinoma -1.200 4.4e-05
mucosa-associated lymphoid tissue lympho... 2.555 2.0e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (14)

PMID Text
25776870 MGAM, or nearby regulatory elements, may be involved in the etiology of oral clefts.
25037326 Starch internal structure modulates its susceptibility to MGAM. The internal branch amounts negatively affect the glucose release rate.
23405089 The over-expression of MGAM was confirmed with a 6.6 fold increase in expression at the mRNA level whereas the fold change in ADAM9 demonstrated a 1.6 fold increase.
22563462 Findings suggest that C-terminal subunits of recombinant maltase-glucoamylase (MGAM) assists alpha-amylase in digesting starch molecules and potentially may compensate for developmental or pathological amylase deficiencies.
22058037 we report crystal structures of C-terminal maltase-glucoamylase alone at a resolution of 3.1 angstroms, and in complex with its inhibitor acarbose
22036121 These results suggest that the N-terminal and C-terminal catalytic domains of maltase-glucoamylase differ in their substrate specificities and inhibitor tolerance despite their structural relationship
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20356844 analysis of substrate selectivity of human maltase-glucoamylase and sucrase-isomaltase N-terminal domains
19913121 Observational study of gene-disease association. (HuGE Navigator)
19472353 This study reported the first diagnosed Finnish patient with a phenotype compatible with the late-onset form of Pompe disease. Molecular genetic analysis of the GAA gene revealed a novel missense mutation (Y575X),combined with (P545L) mutation.
18377903 Acarbose has been found to improve insulin levels and thus glucose/insulin ratios more effectively in overweight patients compared with nonoverweight patients with PCOS.
18036614 Intestinal maltase-glycoamylase: crystal structure of the N-terminal catalytic subunit and basis of inhibition and substrate specificity.
17485087 Raw starch granule degradation with recombinanat human MGAM indicates that pancreatic alpha-amylase hydrolysis is not a requirement for native starch digestion in the human small intestine.
12547908 genetic analysis of MGAM, exon boundaries, and chromosome mapping

AA Sequence

MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTGTPDPGTTGTTHA      1 - 70
RTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHV     71 - 140
EGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAA    141 - 210
ASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNW    211 - 280
KTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYV    281 - 350
FLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDER    351 - 420
RDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGE    421 - 490
VWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILD    491 - 560
GYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNT    561 - 630
ATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFG    631 - 700
ADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVL    701 - 770
DEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGL    771 - 840
IIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEP    841 - 910
SNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTA    911 - 980
RGCIWEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEML    981 - 1050
QFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFI   1051 - 1120
RISTRLPSKYLYGFGETEHRSYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNS   1121 - 1190
NAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIA   1191 - 1260
SLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPYPA   1261 - 1330
FTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEE   1331 - 1400
LYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDASLNHPPYMPHLESRDRGLSSKTLCMESQQIL   1401 - 1470
PDGSLVQHYNVHNLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIG   1471 - 1540
MMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQ   1541 - 1610
TRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRA   1611 - 1680
RWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWL   1681 - 1750
FWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPLKLGYIEIWGVGSVPVTSVSISVSGMV   1751 - 1820
ITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWISTL                                    1821 - 1857
//

Text Mined References (26)

PMID Year Title
25776870 2015 A genome-wide study of inherited deletions identified two regions associated with nonsyndromic isolated oral clefts.
25037326 2014 Branch pattern of starch internal structure influences the glucogenesis by mucosal Nt-maltase-glucoamylase.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23966204 2014 GWAS of human bitter taste perception identifies new loci and reveals additional complexity of bitter taste genetics.
23568457 2013 Genetic variants associated with disordered eating.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23405089 2013 Genome wide analysis of chromosomal alterations in oral squamous cell carcinomas revealed over expression of MGAM and ADAM9.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22563462 2012 Unexpected high digestion rate of cooked starch by the Ct-maltase-glucoamylase small intestine mucosal ?-glucosidase subunit.
22058037 2011 Structural insight into substrate specificity of human intestinal maltase-glucoamylase.
22036121 2011 Study of the inhibition of two human maltase-glucoamylases catalytic domains by different ?-glucosidase inhibitors.
20675712 2010 The perception of quinine taste intensity is associated with common genetic variants in a bitter receptor cluster on chromosome 12.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20356844 2010 Structural basis for substrate selectivity in human maltase-glucoamylase and sucrase-isomaltase N-terminal domains.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19472353 2009 A novel mutation of the GAA gene in a Finnish late-onset Pompe disease patient: clinical phenotype and follow-up with enzyme replacement therapy.
18377903 2008 Clinical, endocrine, and metabolic effects of acarbose, a alpha-glucosidase inhibitor, in overweight and nonoverweight patients with polycystic ovarian syndrome.
18036614 2008 Human intestinal maltase-glucoamylase: crystal structure of the N-terminal catalytic subunit and basis of inhibition and substrate specificity.
17485087 2007 Evidence of native starch degradation with human small intestinal maltase-glucoamylase (recombinant).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12547908 2003 The maltase-glucoamylase gene: common ancestry to sucrase-isomaltase with complementary starch digestion activities.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9446624 1998 Human small intestinal maltase-glucoamylase cDNA cloning. Homology to sucrase-isomaltase.
3143729 1988 Structure, biosynthesis, and glycosylation of human small intestinal maltase-glucoamylase.
3121301 1987 Tyrosine sulfation, a post-translational modification of microvillar enzymes in the small intestinal enterocyte.