Property Summary

NCBI Gene PubMed Count 38
PubMed Score 91.18
PubTator Score 60.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.500 4.3e-04
osteosarcoma 1.939 1.1e-03
atypical teratoid / rhabdoid tumor 1.200 2.5e-07
sonic hedgehog group medulloblastoma 1.300 2.1e-04
medulloblastoma, large-cell 1.100 2.9e-05
non-small cell lung cancer 1.613 1.2e-17
lung cancer 1.600 2.6e-04
Pick disease -1.300 1.6e-04
progressive supranuclear palsy -1.200 3.4e-02
ovarian cancer 2.600 1.2e-06
Breast cancer 1.200 1.9e-06

Protein-protein Interaction (8)

Gene RIF (25)

PMID Text
24824927 miR-19b targets 3'UTR sequences of Mfn1 genes inhibit the expression of Mfn1
24722297 A fine balance of Mfn1 levels is maintained by MARCH5-mediated quality control on acetylated Mfn1.
23713734 In a amyotrophic lateral sclerosis transgenic mouse model, Mfn1 is significantly increased in spinal cord.
23427266 A novel role for the endoplasmic reticulum-associated Gp78 ubiquitin ligase and the Mfn1 mitochondrial fusion factor in mitophagy.
22649485 Knock-out of mitofusin protein Mfn1 increased the frequency of mitochondrial fission with increased lifetime of unpaired events whereas deletion of both Mfn1 and Mfn2 resulted in an instable dynamics.
22484496 These results collectively suggest a role for Mfn1 in regulating the activation of Bax on the outer mitochondrial membrane in a GTPase-dependent manner.
21839087 mitochondrial dynamics, particularly those mediated by the mitofusins, play a role in endothelial cell function and viability.
21615408 Our data supports a model whereby the translocation of parkin to damaged mitochondria induces the degradation of mitofusin 1 leading to impaired mitochondrial fusion
21408142 The impact of mutations in endogenous PINK1 and Parkin on the ubiquitination of mitochondrial fusion and fission factors and the mitochondrial network structure, was investigated.
21173115 Mitofusin degradation by mitochondria-associated Parkin inhibits the fusion of damaged mitochondria with healthy mitochondria to facilitate the selective elimination of the former by autophagy.
20981029 Gbeta2 also regulated the mobility of Mfn1 on the surface of the mitochondrial membrane and affected the mitochondrial fusion.
20974255 Patterned Purkinje cell degeneration is dependent on caspase activation, leading to the marked decrease of mitofusion 1 in the transgenic Harlequin cerebellum.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20871098 Ubiquitination of several mitochondrial proteins, including mitofusin 1 and mitofusin 2 were reduced following the silencing of parkin or PINK1.
20661427 MFN1 is required for both the virus-induced redistribution of IPS-1 and IFN production.
20339081 the NIC-Akt-Mfn signaling cascade identifies a pathway regulating cell-survival, independent of canonical functions associated with NIC activity
20103533 lack of MARCH5 results in mitochondrial elongation, which promotes cellular senescence by blocking Drp1 activity and/or promoting accumulation of Mfn1 at the mitochondria
19754948 Observational study of gene-disease association. (HuGE Navigator)
19168699 IL-6 induces Bcl-2 expression to perform cytoprotective functions in response to oxygen toxicity, and that this effect is mediated by alterations in the interactions between Bak and Mfn1/Mfn2. Bcl-2 inhibited the interaction between Bak and Mfn1.
18832378 Fis1 and Mfn1 activities influence mitochondrial signal generation thereby insulin exocytosis.
17718388 Precise interactions between a few proteins are required for mitochondrial fusion and division. Among them Drp1, Mfn1, Mfn2 and Opal are considered the most important.
15961417 Mfn1, Mfn2, NRF-2 and COX IV mRNA were increased 24 h post-exercise in skeletal muscle
15509649 OPA1 functionally requires mitofusin 1 to regulate mitochondrial fusion
12475957 Mfn1 mediates mitochondrial fusion in human cells
11950885 Results show that Fzo homologs mitofusin 1 and 2 are ubiquitous mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

AA Sequence

MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEV      1 - 70
LSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVN     71 - 140
QLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSES    141 - 210
TLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRI    211 - 280
FFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILAT    281 - 350
VKNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRL    351 - 420
SVLVDEFCSEFHPNPDVLKIYKSELNKHIEDGMGRNLADRCTDEVNALVLQTQQEIIENLKPLLPAGIQD    421 - 490
KLHTLIPCKKFDLSYNLNYHKLCSDFQEDIVFPFSLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLA    491 - 560
STPTAPTTPATPDNASQEELMITLVTGLASVTSRTSMGIIIVGGVIWKTIGWKLLSVSLTMYGALYLYER    561 - 630
LSWTTHAKERAFKQQFVNYATEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPK    631 - 700
EIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES                                 701 - 741
//

Text Mined References (43)

PMID Year Title
24824927 2014 MicroRNA-19b targets Mfn1 to inhibit Mfn1-induced apoptosis in osteosarcoma cells.
24722297 2014 MARCH5-mediated quality control on acetylated Mfn1 facilitates mitochondrial homeostasis and cell survival.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23933751 2013 The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23713734 2013 Mitochondrial fusion and fission proteins expression dynamically change in a murine model of amyotrophic lateral sclerosis.
23427266 2013 Regulation of mitophagy by the Gp78 E3 ubiquitin ligase.
22649485 2012 Multi-patterned dynamics of mitochondrial fission and fusion in a living cell.
22484496 2012 Mitofusin 1 inhibits an apoptosis-associated amino-terminal conformational change in Bax, but not its mitochondrial translocation, in a GTPase-dependent manner.
21839087 2011 Mitofusins are required for angiogenic function and modulate different signaling pathways in cultured endothelial cells.
21615408 2011 Parkin promotes the ubiquitination and degradation of the mitochondrial fusion factor mitofusin 1.
21408142 2011 Mutations in PINK1 and Parkin impair ubiquitination of Mitofusins in human fibroblasts.
21269460 2011 Initial characterization of the human central proteome.
21173115 2010 Proteasome and p97 mediate mitophagy and degradation of mitofusins induced by Parkin.
20981029 2010 G-protein ?2 subunit interacts with mitofusin 1 to regulate mitochondrial fusion.
20974255 2011 Apoptosis inducing factor deficiency causes reduced mitofusion 1 expression and patterned Purkinje cell degeneration.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20871098 2010 Mitofusin 1 and mitofusin 2 are ubiquitinated in a PINK1/parkin-dependent manner upon induction of mitophagy.
20661427 2010 Virus-infection or 5'ppp-RNA activates antiviral signal through redistribution of IPS-1 mediated by MFN1.
20436456 2010 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms.
20339081 2010 Notch-activated signaling cascade interacts with mitochondrial remodeling proteins to regulate cell survival.
20103533 2010 Loss of MARCH5 mitochondrial E3 ubiquitin ligase induces cellular senescence through dynamin-related protein 1 and mitofusin 1.
20019757 2010 Mitochondrial dynamics regulate the RIG-I-like receptor antiviral pathway.
19754948 2009 Evaluation of nine candidate genes in patients with normal tension glaucoma: a case control study.
19168699 2009 IL-6 protects against hyperoxia-induced mitochondrial damage via Bcl-2-induced Bak interactions with mitofusins.
18832378 2008 Selective actions of mitochondrial fission/fusion genes on metabolism-secretion coupling in insulin-releasing cells.
17718388 2007 [Role of transmembrane GTPases in mitochondrial morphology and activity].
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15961417 2005 Mitofusins 1/2 and ERRalpha expression are increased in human skeletal muscle after physical exercise.
15509649 2004 OPA1 requires mitofusin 1 to promote mitochondrial fusion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12759376 2003 Mitofusin-1 protein is a generally expressed mediator of mitochondrial fusion in mammalian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475957 2002 Mitochondrial fusion in human cells is efficient, requires the inner membrane potential, and is mediated by mitofusins.
11950885 2002 Membrane topology and mitochondrial targeting of mitofusins, ubiquitous mammalian homologs of the transmembrane GTPase Fzo.
11751411 2001 Novel transmembrane GTPase of non-small cell lung cancer identified by mRNA differential display.
11181170 2001 Control of mitochondrial morphology by a human mitofusin.
9230308 1997 Developmentally regulated mitochondrial fusion mediated by a conserved, novel, predicted GTPase.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8358434 1993 3,400 new expressed sequence tags identify diversity of transcripts in human brain.