Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.86
PubTator Score 8.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
esophageal adenocarcinoma 1.300 2.3e-02
psoriasis 1.700 1.3e-04
osteosarcoma -2.206 2.1e-06
astrocytoma 1.800 1.1e-02
medulloblastoma -1.100 7.0e-03
Atopic dermatitis 1.200 1.2e-03
intraductal papillary-mucinous adenoma (... 1.700 7.4e-03
intraductal papillary-mucinous carcinoma... 1.600 1.8e-02
lung cancer -1.100 2.0e-02
Breast cancer 2.200 2.9e-02
Pick disease 1.300 7.4e-04
gastric carcinoma 1.200 1.7e-02
ovarian cancer 1.200 5.3e-04

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (6)

PMID Text
23327923 MASL1 expression is upregulated during primary human CD34+ cell erythroid differentiation and is an abundant protein in human red blood cells.
22988871 aim of the review is to summarize the existing information on MASL1 and also to compile data that could be linked to MASL1 [review]
20734064 Observational study of gene-disease association. (HuGE Navigator)
20616063 MFHAS1 regulates Toll-like receptor (TLR)-dependent signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14691450 MASL1, a candidate oncogene found in amplification of 8p23.1, is translocated in an immunoblastic B-cell lymphoma cell line.

AA Sequence

MAGMDSGNLKTARLWRDAALRARKLRSNLRQLTLTAAGACPGAGADALESPASPQLVLPANLGDIEALNL      1 - 70
GNNGLEEVPEGLGSALGSLRVLVLRRNRFARLPPAVAELGHHLTELDVSHNRLTALGAEVVSALRELRKL     71 - 140
NLSHNQLPALPAQLGALAHLEELDVSFNRLAHLPDSLSCLSRLRTLDVDHNQLTAFPRQLLQLVALEELD    141 - 210
VSSNRLRGLPEDISALRALKILWLSGAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNL    211 - 280
SSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQ    281 - 350
GNQIAVLPDHFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAA    351 - 420
GKTLLRHCLTEERVEGCPGGGDKEKCYPPSPPPVSKGIEVTSWTADASRGLRFIVYDLAGDESYEVIQPF    421 - 490
FLSPGALYVLVVNLATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIAL    491 - 560
QEKHDAEGLSRLAKVVDEALARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCR    561 - 630
DPRHLRRLRDKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRL    631 - 700
QSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDILNVFFQRDPSLLLHKLLLGTSGEGKAEGESSPPM    701 - 770
ARSTPSQELLRATQLHQYVEGFLLHGLLPAHVIRLLLKPHVQAQQDLQLLLELLEKMGLCYCLNKPKGKP    771 - 840
LNGSTAWYKFPCYVQNEVPHAEAWINGTNLAGQSFVAEQLQIEYSFPFTFPLGLFARYSVQINSHVVHRS    841 - 910
DGKFQIFAYRGKVPVVVSYRPARGVLQPDTLSIASHASLPNIWTAWQAITPLVEELNVLLQEWPGLHYTV    911 - 980
HILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR    981 - 1050
NQ                                                                       1051 - 1052
//

Text Mined References (18)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24286120 2014 GTP binding controls complex formation by the human ROCO protein MASL1.
23327923 2013 MASL1 induces erythroid differentiation in human erythropoietin-dependent CD34+ cells through the Raf/MEK/ERK pathway.
22988871 2012 MASL1: a neglected ROCO protein.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22210626 2012 Genome-wide association study in multiple human prion diseases suggests genetic risk factors additional to PRNP.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20616063 2011 Human leucine-rich repeat proteins: a genome-wide bioinformatic categorization and functional analysis in innate immunity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18846501 2008 Does parental expressed emotion moderate genetic effects in ADHD? An exploration using a genome wide association scan.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691450 2004 MASL1, a candidate oncogene found in amplification at 8p23.1, is translocated in immunoblastic B-cell lymphoma cell line OCI-LY8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9973190 1999 Identification of a novel gene, MASL1, within an amplicon at 8p23.1 detected in malignant fibrous histiocytomas by comparative genomic hybridization.