Property Summary

NCBI Gene PubMed Count 24
PubMed Score 24.27
PubTator Score 18.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -1.046 1.1e-03
adult high grade glioma 1.500 1.7e-03
Atopic dermatitis -2.100 7.4e-04
breast carcinoma -1.800 1.5e-04
colon cancer -2.000 6.8e-03
cutaneous lupus erythematosus -1.100 1.9e-02
diabetes mellitus -1.200 1.9e-03
ductal carcinoma in situ -1.600 1.9e-02
ependymoma 2.500 6.0e-10
group 3 medulloblastoma 2.300 3.5e-03
intraductal papillary-mucinous adenoma (... -2.300 4.4e-04
intraductal papillary-mucinous carcinoma... -2.500 4.9e-04
intraductal papillary-mucinous neoplasm ... -2.200 8.1e-03
invasive ductal carcinoma -1.460 2.6e-02
lung adenocarcinoma -1.900 2.8e-09
lung cancer -5.200 9.8e-08
lung carcinoma -4.100 2.3e-24
malignant mesothelioma -1.400 1.6e-05
medulloblastoma, large-cell 2.000 5.5e-03
mucosa-associated lymphoid tissue lympho... -1.075 1.3e-02
non-small cell lung cancer -3.080 7.4e-22
pancreatic cancer 1.400 3.5e-03
pituitary cancer -1.500 4.1e-07
primary pancreatic ductal adenocarcinoma 1.219 1.0e-02
psoriasis -1.100 1.9e-03

 IMPC Phenotype (1)

Gene RIF (12)

AA Sequence

MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFC      1 - 70
DMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTA     71 - 140
YAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFR    141 - 210
SCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA                             211 - 255
//

Text Mined References (27)

PMID Year Title