Property Summary

NCBI Gene PubMed Count 6
PubMed Score 20.94
PubTator Score 15.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma 2.405 8.3e-05
sonic hedgehog group medulloblastoma 2.300 5.3e-06
glioblastoma 1.200 6.5e-03
primitive neuroectodermal tumor 1.500 2.9e-05
adrenocortical carcinoma 1.054 1.7e-02
lung cancer 2.700 5.4e-04
pancreatic cancer 1.100 2.9e-04
pediatric high grade glioma 1.300 4.6e-04
aldosterone-producing adenoma -1.097 3.2e-02
acute myeloid leukemia -1.400 1.2e-02
subependymal giant cell astrocytoma -1.091 1.3e-02
lung adenocarcinoma 1.600 3.2e-05
ductal carcinoma in situ 1.600 8.0e-05

AA Sequence

MPSSLGQPDGGGGGGGGGGGVGAAGEDPGPGPAPPPEGAQEAAPAPRPPPEPDDAAAALRLALDQLSALG      1 - 70
LGGAGDTDEEGAAGDGAAAAGGADGGAAPEPVPPDGPEAGAPPTLAPAVAPGSLPLLDPNASPPPPPPPR     71 - 140
PSPPDVFAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTN    141 - 210
TYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAAQGPPNLPGQTTIQVRV    211 - 280
PYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEIEAHITLRTGAFTDAGP    281 - 350
DSDFHANGTDVCLDLLGAAASLWAKTPNQGRRPPTATAGLRGDTALGAPSAPEAFYAGSRGGPSVPDPGP    351 - 420
ASPYSGSGNGGFAFGAEGPGAPVGTAAPDDCDFGFDFDFLALDLTVPAAATIWAPFERAAPLPAFSGCST    421 - 490
VNGAPGPPAAGARRSSGAGTPRHSPTLPEPGGLRLELPLSRRGAPDPVGALSWRPPQGPVSFPGGAAFST    491 - 560
ATSLPSSPAAAACAPLDSGASENSRKPPSASSAPALARECVVCAEGEVMAALVPCGHNLFCMDCAVRICG    561 - 630
KSEPECPACRTPATQAIHIFS                                                     631 - 651
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
17267406 2007 Identification and characterization of human Mex-3 proteins, a novel family of evolutionarily conserved RNA-binding proteins differentially localized to processing bodies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14769789 2004 Identification of TINO: a new evolutionarily conserved BCL-2 AU-rich element RNA-binding protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.