Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.98
PubTator Score 5.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.244 6.1e-05
juvenile dermatomyositis 1.090 3.7e-11
group 3 medulloblastoma 1.400 4.9e-03
Pick disease 1.300 3.4e-06
ovarian cancer -1.800 3.6e-10
cystic fibrosis and chronic rhinosinusit... 1.301 5.4e-03

Gene RIF (3)

PMID Text
27281194 Structure of the METTL3-METTL14 complex
24316715 methyltransferase-like protein 14 in a complex with METTL3 mediates nuclear RNA methylation
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEG      1 - 70
ETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLA     71 - 140
DRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC    141 - 210
WTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAV    211 - 280
FQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRD    281 - 350
STIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG    351 - 420
TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR                                      421 - 456
//

Text Mined References (18)

PMID Year Title
27373337 2016 Structural Basis for Cooperative Function of Mettl3 and Mettl14 Methyltransferases.
27281194 2016 Structural basis of N(6)-adenosine methylation by the METTL3-METTL14 complex.
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
25719671 2015 N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions.
25231264 2014 Affinity proteomic profiling of plasma, cerebrospinal fluid, and brain tissue within multiple sclerosis.
24981863 2014 Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.
24407421 2014 Mammalian WTAP is a regulatory subunit of the RNA N6-methyladenosine methyltransferase.
24316715 2014 A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.