Property Summary

NCBI Gene PubMed Count 45
PubMed Score 91.80
PubTator Score 86.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Protein-protein Interaction (1)

Gene RIF (20)

PMID Text
26935506 Suggest MetAP2 as important regulator of proliferation/apoptosis in non-small cell lung cancers.
25886145 Nt-acetylation prevents the excision of the initiator methionine by MetAP2.
24700462 Data indicate that methionine aminopeptidase 2 (MetAP2) contains a single disulfide bond that exists in oxidized and reduced states and influences enzyme function.
24041691 The activity of unmodified, nitrated and oxidised METAP2 was assessed and it was found that nitration significantly reduced its ability to cleave a chromogenic substrate. Mass spectrometry analysis identified Tyr336 as a nitrated residue in METAP2.
23161775 Increased expression of METAP2 is associated with pilocytic astrocytoma.
21937698 This study demonstrated a hitherto-undescribed role of MetAP2 in definitive hematopoiesis and a possible link to noncanonical Wnt and ERK signaling.
20689807 Observational study of gene-disease association. (HuGE Navigator)
20521764 the substrate specificities of Escherichia coli MetAP1, human MetAP1, and human MetAP2 were systematically profiled
19703310 Data indicate that MetAP2 expression and pp60c-src phosphorylation were decreased in NC2213 treated cells.
18828628 Discovery, identification, and characterization of candidate pharmacodynamic markers of METAP2 inhibition are reported.
18264137 MetAP2 plays an important role in tumor cell growth and may contribute to tumorigenesis
17446530 Data suggest that methionine aminopeptidase 2 plays a role in the proliferation of fibroblasts and myofibroblasts in fibrotic lung diseases and may serve as a novel pharmacologic target in idiopathic pulmonary fibrosis.
16274222 A comparison of the structual differences between Type I and Type II methionine aminopeptidases.
15962312 MetAP-1 and MetAP-2 have essential functions in the control of mammalian cell proliferation
15336565 Expressed in colon cancer cells
15102683 MetAP protein has a role in colorectal adenocarcinoma progression
12718546 Divalent metal cofactors are physiologically relevant for activity of this enzyme.
12118091 High expression in germinal center B cells and their neoplastic counterparts.
11994292 the functional role of S100A4 in regulating endothelial cell growth and tumor metastasis involves interaction with the N-terminal half of Methionine Aminopeptidase 2.
9177176 Using bovine cell extract, fumagillin was found to be bound by methionine aminopeptidase (MetAP-2).

AA Sequence

MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKESGASVDEVARQ      1 - 70
LERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPT     71 - 140
QDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKE    141 - 210
NGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAV    211 - 280
KDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGG    281 - 350
EATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL    351 - 420
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY                421 - 478
//

Text Mined References (60)

PMID Year Title
26935506 Methionine Aminopeptidase 2 as a Potential Therapeutic Target for Human Non-Small-Cell Lung Cancers.
25886145 2015 N-terminal acetylome analysis reveals the specificity of Naa50 (Nat5) and suggests a kinetic competition between N-terminal acetyltransferases and methionine aminopeptidases.
24700462 2014 Redox regulation of methionine aminopeptidase 2 activity.
24611021 2014 Inhibition of the methionine aminopeptidase 2 enzyme for the treatment of obesity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24041691 2013 Tyrosine nitration moderates the peptidase activity of human methionyl aminopeptidase 2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161775 2013 MicroRNA profiling in pediatric pilocytic astrocytoma reveals biologically relevant targets, including PBX3, NFIB, and METAP2.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21937698 2011 Methionine aminopeptidase 2 is required for HSC initiation and proliferation.
21537465 2010 Localization and function of a eukaryotic-initiation-factor-2-associated 67-kDa glycoprotein.
21269460 2011 Initial characterization of the human central proteome.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20521764 2010 Protein N-terminal processing: substrate specificity of Escherichia coli and human methionine aminopeptidases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19703310 2009 NC2213: a novel methionine aminopeptidase 2 inhibitor in human colon cancer HT29 cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18828628 2008 Discovery, identification, and characterization of candidate pharmacodynamic markers of methionine aminopeptidase-2 inhibition.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18264137 2008 Ectopic expression of methionine aminopeptidase-2 causes cell transformation and stimulates proliferation.
17636946 2007 Highly potent inhibitors of methionine aminopeptidase-2 based on a 1,2,4-triazole pharmacophore.
17446530 2007 Methionine aminopeptidase-2 as a selective target of myofibroblasts in pulmonary fibrosis.
17350258 2007 Lead optimization of methionine aminopeptidase-2 (MetAP2) inhibitors containing sulfonamides of 5,6-disubstituted anthranilic acids.
16790550 2006 Targeted gene disruption of methionine aminopeptidase 2 results in an embryonic gastrulation defect and endothelial cell growth arrest.
16632353 2006 Development of sulfonamide compounds as potent methionine aminopeptidase type II inhibitors with antiproliferative properties.
16541075 2006 The finished DNA sequence of human chromosome 12.
16540317 2006 Human methionine aminopeptidase type 2 in complex with L- and D-methionine.
16386852 2006 Methionine aminopeptidase 2 and cancer.
16274222 2005 Structural basis for the functional differences between type I and type II human methionine aminopeptidases.
16267007 2005 Cerebrospinal fluid proteomic analysis reveals dysregulation of methionine aminopeptidase-2 expression in human and mouse neurofibromatosis 1-associated glioma.
16160854 2005 Molecular analysis of a constitutional complex genome rearrangement with 11 breakpoints involving chromosomes 3, 11, 12, and 21 and a approximately 0.5-Mb submicroscopic deletion in a patient with mild mental retardation.
16134930 2005 4-Aryl-1,2,3-triazole: a novel template for a reversible methionine aminopeptidase 2 inhibitor, optimized to inhibit angiogenesis in vivo.
15962312 2005 Methionine aminopeptidases type I and type II are essential to control cell proliferation.
15814649 2005 Methionine aminopeptidase 2 inhibition is an effective treatment strategy for neuroblastoma in preclinical models.
15544353 2004 Treatment of cells with the angiogenic inhibitor fumagillin results in increased stability of eukaryotic initiation factor 2-associated glycoprotein, p67, and reduced phosphorylation of extracellular signal-regulated kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15336565 2004 Expression of methionine aminopeptidase 2, N-myristoyltransferase, and N-myristoyltransferase inhibitor protein 71 in HT29.
15126329 2004 Depletion of methionine aminopeptidase 2 does not alter cell response to fumagillin or bengamides.
15102683 2004 High expression of methionine aminopeptidase 2 in human colorectal adenocarcinomas.
15012983 2004 3-Amino-2-hydroxyamides and related compounds as inhibitors of methionine aminopeptidase-2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14534293 2003 Proteomics-based target identification: bengamides as a new class of methionine aminopeptidase inhibitors.
14532271 2003 An unusual peptide deformylase features in the human mitochondrial N-terminal methionine excision pathway.
12718546 2003 Physiologically relevant metal cofactor for methionine aminopeptidase-2 is manganese.
12581743 2003 Negative regulation of the protection of eIF2alpha phosphorylation activity by a unique acidic domain present at the N-terminus of p67.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11994292 2002 Methionine aminopeptidase 2 is a new target for the metastasis-associated protein, S100A4.
11485930 2001 Methionine aminopeptidase-2 regulates human mesothelioma cell survival: role of Bcl-2 expression and telomerase activity.
11123929 2000 In vivo regulation of the dsRNA-dependent protein kinase PKR by the cellular glycoprotein p67.
10388536 1999 Increased phosphorylation of eukaryotic initiation factor 2alpha at the G2/M boundary in human osteosarcoma cells correlates with deglycosylation of p67 and a decreased rate of protein synthesis.
9860943 1998 Molecular recognition of angiogenesis inhibitors fumagillin and ovalicin by methionine aminopeptidase 2.
9812898 1998 Structure of human methionine aminopeptidase-2 complexed with fumagillin.
9177176 1997 The anti-angiogenic agent fumagillin covalently binds and inhibits the methionine aminopeptidase, MetAP-2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8858118 1996 Evidence that the human homologue of a rat initiation factor-2 associated protein (p67) is a methionine aminopeptidase.
8098621 1993 Characteristics of the eukaryotic initiation factor 2 associated 67-kDa polypeptide.
7873610 1995 Molecular cloning of a human complementary DNA encoding an initiation factor 2-associated protein (p67).
7738010 1995 A 68-kDa kinase and NADPH oxidase component p67phox are targets for Cdc42Hs and Rac1 in neutrophils.
7644482 1995 Eukaryotic methionyl aminopeptidases: two classes of cobalt-dependent enzymes.
2511207 1989 Glycosylation of eukaryotic peptide chain initiation factor 2 (eIF-2)-associated 67-kDa polypeptide (p67) and its possible role in the inhibition of eIF-2 kinase-catalyzed phosphorylation of the eIF-2 alpha-subunit.