Property Summary

Ligand Count 346
NCBI Gene PubMed Count 45
PubMed Score 8.18
PubTator Score 86.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Protein-protein Interaction (5)

PDB (26)

Gene RIF (20)

AA Sequence

MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKESGASVDEVARQ      1 - 70
LERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPT     71 - 140
QDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKE    141 - 210
NGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAV    211 - 280
KDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGG    281 - 350
EATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL    351 - 420
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY                421 - 478
//

Text Mined References (60)

PMID Year Title