Property Summary

NCBI Gene PubMed Count 48
PubMed Score 128.62
PubTator Score 151.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
pancreatic cancer 1.200 3.5e-03
malignant mesothelioma -9.700 2.3e-10
oligodendroglioma 1.300 2.5e-02
esophageal adenocarcinoma 1.800 1.8e-02
glioblastoma 2.600 5.0e-03
sonic hedgehog group medulloblastoma 1.600 1.2e-04
cystic fibrosis -2.054 4.2e-06
atypical teratoid / rhabdoid tumor 3.000 1.3e-08
primitive neuroectodermal tumor 1.900 2.8e-03
Duchenne muscular dystrophy 2.378 1.9e-09
autosomal dominant Emery-Dreifuss muscul... 2.107 3.0e-03
Becker muscular dystrophy 1.253 6.1e-03
juvenile dermatomyositis 2.000 1.7e-11
limb girdle muscular dystrophy 2B 1.346 2.5e-03
tuberculosis 1.200 1.2e-03
non-small cell lung cancer 1.481 1.2e-12
active ulcerative colitis -1.154 3.3e-03
breast carcinoma -1.600 7.1e-03
adult high grade glioma 2.000 6.9e-04
pilocytic astrocytoma 1.800 4.4e-07
pancreatic carcinoma 1.200 3.5e-03
lung adenocarcinoma 1.108 4.9e-03
invasive ductal carcinoma -1.700 9.5e-03
nasopharyngeal carcinoma 1.600 4.3e-02
Pick disease -1.300 1.9e-02
Breast cancer -1.400 2.8e-03
gastric carcinoma 2.000 4.0e-02
ductal carcinoma in situ -1.800 2.9e-03
ovarian cancer 3.400 1.9e-05

 GO Function (1)

Gene RIF (27)

PMID Text
23775149 altered DNA methylation at imprinted domains including IGF2/H19 and PEG1/MEST may mediate the association between human papillomavirus infection and invasive cervical cancer
23415968 Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages.
23343754 DNA methylation level at the H19 and MEST differentially methylated regions (DMRs)is reduced in placentas from pregnancies conceived by IVF/ICSI when compared with placentas from spontaneous conception.
23229728 The expression levels of miR-335 significantly correlated with those of MEST, supporting the notion that the intronic miR-335 is co-expressed with its host gene
23209187 These results support the idea that intrauterine exposure to gestational diabetes mellitus has long-lasting effects on the epigenome of the offspring.
22531794 MEST showed tissue-specific imprinting, being paternally expressed in skeletal muscle, fat, pituitary gland, heart, kidney, lung, stomach and uterus, and maternally expressed in spleen and liver.
22456293 In cortices, the MEST promoter was hemimethylated, as expected for a differentially methylated imprinting control region, whereas the COPG2 and TSGA14 promoters were completely demethylated, typical for transcriptionally active non-imprinted genes.
22249249 Data indicate that ARMCX2, COL1A1, MDK, MEST and MLH1 genes acquired methylation in drug-resistant ovarian cancer-sustaining (side population) cells.
21575949 Regardless of conception method, the PEG1 methylation percentage in chorionic villus from spontaneous abortions is significantly higher than in villus from induced abortions and multifetal reduction.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20339302 data demonstrated that tumorigenesis of leiomyoma is associated with overexpression of isoform 1 of PEG1/MEST gene, but not with loss of imprinting of the gene
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18644838 MEST is localized to the endoplasmic reticulum/Golgi apparatus where its putative enzymatic properties as a lipase or acyltransferase, predicted from sequence homology with members of the alpha/beta fold hydrolase superfamily.
18585117 Type of epimutation at the PEG1/MEST locus does not play a relevant role in Silver-Russell syndrome.
17450433 Hypermethylation of paternally expressed genes including PEG1/MEST, which have growth-promoting effects, may be relevant to low birth weight in subjects conceived by assisted reproduction techniques.
16338457 PEG1 isoform 2 is in fact imprinted in a large subset of human placentae.
15547750 Lof imprinting of PEG1/MESTOI may be related to tumorigenesis and malignant transformation, especially in NSCLC
12095916 An intron contains a sequence, MESTIT1, which is transcribed only from the paternal allele, may be involved in MEST regulation
12023987 a novel mechanism /promoter switch/ leading to biallelic expression in invasive breast cancer
11920156 Mutation screening and imprinting analysis of candidate genes for autism in the 7q32 region
11821432 An imprinted PEG1/MEST antisense expressed predominantly in human testis and in mature spermatozoa.
11754049 Findings suggest that PEG1/MEST can be excluded as a major determinant of Silver-Russell syndrome.
10631159 MEST gene is imprinted in an isoform-specific manner in adult lymphocytes.
9192843 MEST gene is imprinted, with preferential expression from the paternal allele in fetal tissues.

AA Sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQDSVGVVGSPE      1 - 70
IVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRR     71 - 140
INLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNF    141 - 210
FVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIY    211 - 280
GPLDPVNPYPEFLELYRKTLPRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF                   281 - 335
//

Text Mined References (50)

PMID Year Title
23775149 2014 PEG1/MEST and IGF2 DNA methylation in CIN and in cervical cancer.
23415968 2013 Methylation status of imprinted genes DLK1-GTL2, MEST (PEG1), ZAC (PLAGL1), and LINE-1 elements in spermatozoa of normozoospermic men, unlike H19 imprinting control regions, is not associated with idiopathic recurrent spontaneous miscarriages.
23343754 2013 Placentas from pregnancies conceived by IVF/ICSI have a reduced DNA methylation level at the H19 and MEST differentially methylated regions.
23229728 2013 Epigenetic silencing of miR-335 and its host gene MEST in hepatocellular carcinoma.
23209187 2013 Metabolic programming of MEST DNA methylation by intrauterine exposure to gestational diabetes mellitus.
22531794 2012 Conservation of genomic imprinting at the NDN, MAGEL2 and MEST loci in pigs.
22456293 2012 Methylation and expression analyses of the 7q autism susceptibility locus genes MEST , COPG2, and TSGA14 in human and anthropoid primate cortices.
22249249 2012 Candidate DNA methylation drivers of acquired cisplatin resistance in ovarian cancer identified by methylome and expression profiling.
21575949 2011 Assisted reproductive technologies do not increase risk of abnormal methylation of PEG1/MEST in human early pregnancy loss.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20339302 2010 Imprinting and expression status of isoforms 1 and 2 of PEG1/MEST gene in uterine leiomyoma.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18644838 2008 Mesoderm-specific transcript is associated with fat mass expansion in response to a positive energy balance.
18585117 No evidence for isolated imprinting mutations in the PEG1/MEST locus in Silver-Russell patients.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17450433 2007 Silver-Russell syndrome in a girl born after in vitro fertilization: partial hypermethylation at the differentially methylated region of PEG1/MEST.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16338457 Imprinting of PEG1/MEST isoform 2 in human placenta.
15547750 2004 Loss of imprinting of PEG1/MEST in lung cancer cell lines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754712 2003 A multiplex methylation PCR assay for identification of uniparental disomy of chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12095916 2002 Identification and characterization of an imprinted antisense RNA (MESTIT1) in the human MEST locus on chromosome 7q32.
12023987 2002 Promoter switch: a novel mechanism causing biallelic PEG1/MEST expression in invasive breast cancer.
11920156 2002 Mutation screening and imprinting analysis of four candidate genes for autism in the 7q32 region.
11821432 2002 An imprinted PEG1/MEST antisense expressed predominantly in human testis and in mature spermatozoa.
11754049 2001 No evidence of PEG1/MEST gene mutations in Silver-Russell syndrome patients.
11718568 2001 Post-zygotic origin of complete maternal chromosome 7 isodisomy and consequent loss of placental PEG1/MEST expression.
11536368 2001 Frequent loss of imprinting of IGF2 and MEST in lung adenocarcinoma.
10958657 2000 Establishment of the paternal methylation imprint of the human H19 and MEST/PEG1 genes during spermatogenesis.
10955473 2000 Maternal chromosome 7 hetero/isodisomy in Silver-Russell syndrome and PEG1 biallelic expression.
10860668 2000 Construction of a physical and transcript map flanking the imprinted MEST/PEG1 region at 7q32.
10679925 2000 Expression of the imprinted genes MEST/Mest in human and murine placenta suggests a role in angiogenesis.
10631159 2000 Isoform-specific imprinting of the human PEG1/MEST gene.
10554015 1999 Frequent loss of imprinting of PEG1/MEST in invasive breast cancer.
9781054 Evidence against a major role of PEG1/MEST in Silver-Russell syndrome.
9526615 1997 PEG1 expression in maternal uniparental disomy 7.
9192843 1997 Monoallelic expression of human PEG1/MEST is paralleled by parent-specific methylation in fetuses.
9158153 1997 Human PEG1/MEST, an imprinted gene on chromosome 7.
8884280 1996 Genomic imprinting and chromosomal localization of the human MEST gene.