Property Summary

Ligand Count 79
NCBI Gene PubMed Count 109
PubMed Score 199.07
PubTator Score 118.52

Knowledge Summary

Patent (31,823)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Liver Cirrhosis 181 0.0 3.0
Multiple Sclerosis 540 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical adenoma 1.251 3.2e-03
astrocytoma 1.500 1.5e-02
Atopic dermatitis -1.300 1.1e-03
Breast cancer -1.400 8.2e-08
glioblastoma 1.700 6.8e-03
group 3 medulloblastoma -1.800 6.1e-04
intraductal papillary-mucinous adenoma (... -1.600 3.5e-04
intraductal papillary-mucinous carcinoma... -1.800 8.5e-05
intraductal papillary-mucinous neoplasm ... -1.800 1.4e-03
medulloblastoma, large-cell -2.800 6.6e-05
osteosarcoma 1.850 4.2e-03
ovarian cancer 1.500 2.1e-04
pancreatic cancer 1.400 1.2e-03
pancreatic carcinoma 1.400 1.2e-03
pancreatic ductal adenocarcinoma liver m... -1.470 1.1e-03
pituitary cancer -1.600 5.4e-05
posterior fossa group A ependymoma -1.100 7.5e-05
psoriasis -1.200 5.2e-05

PDB (13)

Gene RIF (93)

AA Sequence

MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQP      1 - 70
GRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGA     71 - 140
HHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTR    141 - 210
NTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINI    211 - 280
KAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQ    281 - 350
ALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY    351 - 420
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHGWVDYAP    421 - 490
SSTPAPGNADPVLIIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTEEDSELVVNYIAKKSFCRRAI    491 - 560
ELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQRE    561 - 630
IEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTL    631 - 700
LKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIE    701 - 770
SLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTD    771 - 840
PLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRA    841 - 910
AISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSS    911 - 980
LPDELLFADDSSEGSEVLM                                                       981 - 999
//

Text Mined References (117)

PMID Year Title