Property Summary

NCBI Gene PubMed Count 94
PubMed Score 172.92
PubTator Score 118.52

Knowledge Summary

Patent (31,823)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Liver Cirrhosis 101 0.0 2.0
Multiple Sclerosis 498 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer 1.400 1.2e-03
psoriasis -1.400 9.0e-04
osteosarcoma 1.850 4.2e-03
group 4 medulloblastoma -2.000 1.7e-06
astrocytoma 1.500 1.5e-02
glioblastoma 1.700 6.8e-03
medulloblastoma, large-cell -2.800 6.6e-05
Atopic dermatitis -1.300 1.1e-03
adrenocortical adenoma 1.251 3.2e-03
pancreatic ductal adenocarcinoma liver m... -1.470 1.1e-03
intraductal papillary-mucinous adenoma (... -1.600 3.5e-04
intraductal papillary-mucinous carcinoma... -1.800 8.5e-05
intraductal papillary-mucinous neoplasm ... -1.800 1.4e-03
posterior fossa group B ependymoma -1.200 1.5e-04
pancreatic carcinoma 1.400 1.2e-03
Breast cancer -1.400 8.2e-08
ovarian cancer 1.500 2.1e-04
pituitary cancer -1.900 1.5e-06

Protein-protein Interaction (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (78)

PMID Text
27122965 We report a novel missense mutation (c.3G>A, p.0?) in the MERTK gene that causes severe vision impairment in a patient.
26990204 One of the associated variants was also found to be linked with increased expression of MERTK in monocytes and higher expression of MERTK was associated with either increased or decreased risk of developing MS, dependent upon HLA-DRB1*15:01 status.
26962228 The current study demonstrates the contribution of the TAM receptor MerTK to the phagocytosis of myelin by human adult microglia and monocyte-derived macrophages.
26819373 Combined Mertk (and Mfge8) deficiency in macrophages blunted VEGFA release from infarcted hearts.
26427488 Data show that activated AMP-activated protein kinase (AMPK) limits retinal pigment epithelial cells (RPE) phagocytic activity by abolishing retinal photoreceptor cell outer segment (POS)-induced activation of c-mer proto-oncogene tyrosine kinase (MerTK).
26427450 Data indicate that AAV2-VMD2-c-mer proto-oncogene protein (hMERTK) provided up to 6.5 months photoreceptor rescue in the RCS rat, and also had a major protective effect in Mertk-null mice.
26427420 Studies indicate that c-Mer receptor tyrosine kinase MERTK mutations cause retinal degenerations.
26316303 Utilizing an ex vivo co-cultivation approach to model key cellular and molecular events found in vivo during infarction, cardiomyocyte phagocytosis was found to be inefficient, in part due to myocyte-induced shedding of macrophage MERTK
26263531 Upon differentiation of these iPSC towards RPE, patient-specific RPE cells exhibited defective phagocytosis, a characteristic phenotype of MERTK deficiency observed in human patients and animal models
25881761 The mRNA expression levels of Tyro-3, Axl were decreased in pSS patients. When considering the plasma level, increased levels of soluble Mer was observed with statistically significant difference.
25878564 Significantly increased levels of sMer, sTyro3 and sAxl may be important factors contributing to the deficit in phagocytosis ability in systemic lupus erythematosus .
25826078 Mer enhances malignant phenotype and pharmacological inhibition of Mer overcomes resistance of non-small cell lung cancer to EGFR-targeted agents.
25762638 UNC1666 is a novel potent small molecule tyrosine kinase inhibitor that decreases oncogenic signaling and myeloblast survival by dual Mer/Flt3 inhibition.
25695599 results identify Mer as a receptor uniquely capable of both tethering ACs to the macrophage surface and driving their subsequent internalization.
25624460 MERTK on DCs controls T cell activation and expansion through the competition for PROS1 interaction with MERTK in the T cells. MERTK is a potent suppressor of T cell response.
25479139 Patients with ACLF have increased numbers of immunoregulatory monocytes and macrophages that express MERTK and suppress the innate immune response to microbes. The number of these cells correlates with disease severity and the inflammatory response.
25450174 The key role of the MERTK could be demonstrated in HMDM engulfing dying cells using gene silencing as well as blocking antibodies. Similar pathways were found upregulated in living ARPE-19 engulfing anoikic ARPE-19 cells.
25428221 Mer expression correlates with CNS positivity upon initial diagnosis in t(1;19)-positive pediatric acute lymphoblastic leukemia patients.
25102945 Inhibition of the Gas6 receptor Mer or therapeutic targeting of Gas6 by warfarin is a promising strategy for the treatment of multiple myeloma.
25074939 These data collectively identify MERTK as a significant link between cancer progression and efferocytosis, and a potentially unrealized tumor-promoting event when MERTK is overexpressed in epithelial cells.
25074926 These studies demonstrate that, despite their similarity, TYRO3, AXL, and MER are likely to perform distinct functions in both immunoregulation and the recognition and removal of apoptotic cells
24939420 The MER receptor pathway promotes wound repair in macrophages and epithelial cell growth.
24741600 Both mMer and sMer levels significantly increased in SLE and positively correlated with disease activity and severity. The upregulation of MerTK expression may serve as a biomarker of the disease activity and severity of SLE.
23835724 MerTK expression in circulating innate immune cells is increased in patients with septic shock in comparison with healthy volunteers and trauma patients and its persistent overexpression after septic shock is associated with adverse outcome.
23662598 [review] Receptor tyrosine kinases Tyro-3, Axl and Mer, collectively designated as TAM, are involved in the clearance of apoptotic cells.
23617806 MERTK has a role in regulating melanoma cell migration and survival and differentially regulates cell behavior relative to AXL
23585477 MERTK expression correlates with disease progression in metastatic melanomas, primary melanomas, and nevi
23474756 data suggest a role for Mer in acute myeloid leukemogenesis and indicate that targeted inhibition of Mer may be an effective therapeutic strategy in pediatric and adult AML
23390493 MERTK signaling in the retinal pigment epithelium involves a cohort of SH2-domain proteins with the potential to regulate both cytoskeletal rearrangement and membrane movement.
23065156 The tyrosine kinase receptor MER is activated by PROS and mediates its inhibitory effect on VEGF-A-induced EC proliferation.
22997156 Oxidized of polyunsaturated fatty acids contained in the tissue close to necrotic core of human carotid plaques are strong inducers of Adam17, which in turn may cleave the extracellular domain of Mertk giving rise to sMer.
22942426 MerTK expression levels adapt to changing immunologic environment, being suppressed in M1 and M2a macrophages and in dendritic cells.
22890323 These results indicate that Mer and Axl have complementary and overlapping roles in Non-small cell lung cancer
22841784 The single nucleotide polymorphisms rs4374383 and rs9380516 were linked to the functionally related genes MERTK and TULP1, which encode factors involved in phagocytosis of apoptotic cells by macrophages.
22469987 Mer receptor tyrosine kinase promotes invasion and survival in glioblastoma multiforme.
22363695 The present study explores Mer behavior following prolonged exposure to Gas6.
22180149 MERTK mutations lead to severe retinitis pigmentosa with discrete dot-like autofluorescent deposits at early stages, which are a hallmark of this MERTK-specific dystrophy.
21792939 This study identified galectin-3 as a new MerTK ligand by an advanced dual functional cloning strategy.
21677792 A novel MERTK deletion is a common founder mutation in the Faroe Islands and is responsible for a high proportion of retinitis pigmentosa cases.
21542987 Gene expression profile is changed by the dysfunction of Mer during retinal pigment epithelium phagocytosis.(
21496228 plasma concentrations of sMer and sTyro3 were significantly increased in patients with active systemic lupus erythematosis and Rheumatoid arthritis
21384080 overexpressed in atherosclerotic carotid plaques
21347448 MERTK gene is a novel risk gene for multiple sclerosis susceptibility
20978472 Tubby and Tulp1 are bridging molecules with their N-terminal region as MERTK-binding domain and C-terminal region as phagocytosis prey-binding domain.
20959443 PMN-Ect interacted with the macrophages by activation of the MerTK pathway responsible for down-modulation of the proinflammatory signals generated by ZymA.
20801516 Observational study of genetic testing. (HuGE Navigator)
20664904 Findings indicate genetic association between MERTK and TYRO3 allelic variants and carotid atherosclerosis.
20664904 Observational study of gene-disease association. (HuGE Navigator)
20654219 The lower activity of PKC and the higher expression of MERTK are very important for sustaining the phagocytic process of ROS by human retinal pigment epithelial cells.
20637106 correlation of decreased protein S levels with lupus disease activity is consistent with a role for the TAM receptors in scavenging apoptotic cells and controlling inflammation
20591486 Observational study of genetic testing. (HuGE Navigator)
20546121 Gas6 and Tyro3, Axl and Mer (TAM) receptors have roles in human and murine platelet activation and thrombus stabilization
20538656 results strongly suggest that the nonsense mutation in MERTK, leading to premature termination of the protein, is responsible for retinitis pigmentosa phenotype in the affected individuals of the Pakistani family.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20300561 The phenotype associated with these identified MERTK mutations is of a childhood onset rod-cone dystrophy with early macular atrophy.
20130272 Homozygosity mapping and mutation analysis in the distant family member affected by RP revealed a homozygous mutation in MERTK, but no CEP290 mutations.
19922767 data suggest that growth arrest-specific-6 (GAS6)/MER receptor tyrosine kinase axis regulates homing and survival of the E2A/PBX1-positive B-cell precursor acute lymphoblastic leukemia in the bone marrow niche
19541935 there was a negative correlation between Gas6 and soluble Axl and Mer in established multiple sclerosis lesions. In addition, increased levels of soluble Axl and Mer were associated with increased levels of mature ADAM17, mature ADAM10, and Furin
19403518 The splice site mutation c.2189+1G>T in MERTK causes rod-cone dystrophy with a distinct macular phenotype.
18922854 human protein S can inhibit the expression and activity of SR-A through Mer RTK in macrophages, suggesting that human protein S is a modulator for macrophage functions in uptaking of modified lipoproteins
18815424 IVS16+1G>T disrupts the splice donor site causing exon 16 skipping. Absence of exon 16 causes a frameshift and the introduction of a premature termination codon into exon 17 creating an altered mRNA with a seriously affected tyrosine kinase domain.
18620092 Possible strategies for targeted inhibition of the TAM family in the treatment of human cancer.
18587056 MERTK, a cell surface receptor that recognizes apoptotic cells, is expressed on human alveolar macrophages (AMs), and its expression is up-regulated in AMs of cigarette smokers.
18250462 MerTK macrophage receptor is an essential component required for serum-stimulated phagocytosis of apoptotic cells.
18246816 Overexpressed Mer tyrosine kinase receptor can inhibit the migration and angiogenesis of HMEC-1 cells through VEGF-C/VEGFR-2 signal pathway.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18039660 Tyr-867 in Mer receptor tyrosine kinase allows for dissociation of multiple signaling pathways for phagocytosis of apoptotic cells and down-modulation of lipopolysaccharide-inducible NF-kappaB transcriptional activation
17626743 Mer is highly expressed on Jurkat cells, and could inhibit cell apoptosis via Bcl-2 signaling pathway.
17047157 cleavage results in production of a soluble Mer protein that prevented Gas6-mediated stimulation of membrane-bound Mer. Mer inhibition led to defective macrophage-mediated engulfment of apoptotic cells and decreased platelet aggregation
17005688 Here we show the involvement of members of the Tyro3 receptor tyrosine kinase family-Axl, Dtk, and Mer-in cell entry of filoviruses.
16837475 Observational study of gene-disease association. (HuGE Navigator)
16710167 Mutations in the MERTK gene are relatively rare in Japanese patients with autosomal recessive retinitis pigmentosa.
16675557 Transforming Mer signals may contribute to T-cell leukemogenesis, and abnormal Mer expression may be a novel therapeutic target in pediatric acute lymhpocytic leukemia therapy.
15733062 Axl, Sky and Mer are Gas6 receptors that enhance platelet activation and regulate thrombotic responses
15130911 mer, presumably through activation by its ligand Gas6, participates in regulation of platelet function in vitro and platelet-dependent thrombosis in vivo.
15111602 The present study reports the identification of R844C, the first putative pathogenic MERTK missense mutation that results in severe retinal degeneration with childhood onset
12768229 Gas6 receptors were not upregulated in any of the allograft groups, except for the Axl receptor, which increased only in acute tubular necrosis.
11727200 retinal dystrophy due to paternal isodisomy for chromosome 1 or chromosome 2, with homoallelism for mutations in RPE65 or MERTK, respectively

AA Sequence

MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQP      1 - 70
GRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGA     71 - 140
HHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTR    141 - 210
NTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINI    211 - 280
KAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQ    281 - 350
ALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY    351 - 420
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHGWVDYAP    421 - 490
SSTPAPGNADPVLIIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTEEDSELVVNYIAKKSFCRRAI    491 - 560
ELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQRE    561 - 630
IEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTL    631 - 700
LKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIE    701 - 770
SLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTD    771 - 840
PLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRA    841 - 910
AISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSS    911 - 980
LPDELLFADDSSEGSEVLM                                                       981 - 999
//

Text Mined References (102)

PMID Year Title
27122965 2016 A novel start codon mutation of the MERTK gene in a patient with retinitis pigmentosa.
26990204 2016 Common and Low Frequency Variants in MERTK Are Independently Associated with Multiple Sclerosis Susceptibility with Discordant Association Dependent upon HLA-DRB1*15:01 Status.
26962228 2016 MerTK Is a Functional Regulator of Myelin Phagocytosis by Human Myeloid Cells.
26819373 2016 Myeloid-Epithelial-Reproductive Receptor Tyrosine Kinase and Milk Fat Globule Epidermal Growth Factor 8 Coordinately Improve Remodeling After Myocardial Infarction via Local Delivery of Vascular Endothelial Growth Factor.
26427488 2016 Blockade of MerTK Activation by AMPK Inhibits RPE Cell Phagocytosis.
26427450 2016 Gene Therapy for MERTK-Associated Retinal Degenerations.
26427420 2016 A Comprehensive Review of Mutations in the MERTK Proto-Oncogene.
26316303 2015 Cardiomyocytes induce macrophage receptor shedding to suppress phagocytosis.
26263531 2015 Human iPSC derived disease model of MERTK-associated retinitis pigmentosa.
25881761 2015 The association of Tyro3/Axl/Mer signaling with inflammatory response, disease activity in patients with primary Sjögren's syndrome.
25878564 2015 Increased soluble phagocytic receptors sMer, sTyro3 and sAxl and reduced phagocytosis in juvenile-onset systemic lupus erythematosus.
25826078 2015 Mer receptor tyrosine kinase is frequently overexpressed in human non-small cell lung cancer, confirming resistance to erlotinib.
25762638 2015 Efficacy of a Mer and Flt3 tyrosine kinase small molecule inhibitor, UNC1666, in acute myeloid leukemia.
25695599 2015 Mer receptor tyrosine kinase mediates both tethering and phagocytosis of apoptotic cells.
25624460 2015 MERTK as negative regulator of human T cell activation.
25479139 2015 Patients with acute-on-chronic liver failure have increased numbers of regulatory immune cells expressing the receptor tyrosine kinase MERTK.
25450174 2015 Triamcinolone regulated apopto-phagocytic gene expression patterns in the clearance of dying retinal pigment epithelial cells. A key role of Mertk in the enhanced phagocytosis.
25428221 2015 Mer tyrosine kinase promotes the survival of t(1;19)-positive acute lymphoblastic leukemia (ALL) in the central nervous system (CNS).
25102945 2015 Role of Growth arrest-specific gene 6-Mer axis in multiple myeloma.
25074939 2014 Overexpression of MERTK receptor tyrosine kinase in epithelial cancer cells drives efferocytosis in a gain-of-function capacity.
25074926 2014 Receptor tyrosine kinases, TYRO3, AXL, and MER, demonstrate distinct patterns and complex regulation of ligand-induced activation.
24939420 2014 RhoA/phosphatidylinositol 3-kinase/protein kinase B/mitogen-activated protein kinase signaling after growth arrest-specific protein 6/mer receptor tyrosine kinase engagement promotes epithelial cell growth and wound repair via upregulation of hepatocyte growth factor in macrophages.
24741600 2014 The expression and clinical significance of different forms of Mer receptor tyrosine kinase in systemic lupus erythematosus.
23835724 2013 Increased MerTK expression in circulating innate immune cells of patients with septic shock.
23662598 2013 TAM receptors in apoptotic cell clearance, autoimmunity, and cancer.
23617806 2013 MERTK controls melanoma cell migration and survival and differentially regulates cell behavior relative to AXL.
23585477 2013 MERTK receptor tyrosine kinase is a therapeutic target in melanoma.
23474756 2013 Aberrant Mer receptor tyrosine kinase expression contributes to leukemogenesis in acute myeloid leukemia.
23390493 2013 MERTK interactions with SH2-domain proteins in the retinal pigment epithelium.
23353780 2013 Inhibition of MerTK increases chemosensitivity and decreases oncogenic potential in T-cell acute lymphoblastic leukemia.
23065156 2012 The vitamin K-dependent anticoagulant factor, protein S, inhibits multiple VEGF-A-induced angiogenesis events in a Mer- and SHP2-dependent manner.
22997156 2013 Expansion of necrotic core and shedding of Mertk receptor in human carotid plaques: a role for oxidized polyunsaturated fatty acids?
22942426 2012 Efficient clearance of early apoptotic cells by human macrophages requires M2c polarization and MerTK induction.
22890323 2013 Mer or Axl receptor tyrosine kinase inhibition promotes apoptosis, blocks growth and enhances chemosensitivity of human non-small cell lung cancer.
22841784 2012 Genome-wide association study identifies variants associated with progression of liver fibrosis from HCV infection.
22469987 2013 Mer receptor tyrosine kinase promotes invasion and survival in glioblastoma multiforme.
22363695 2012 Prolonged exposure to a Mer ligand in leukemia: Gas6 favors expression of a partial Mer glycoform and reveals a novel role for Mer in the nucleus.
22180149 Homozygous mutation in MERTK causes severe autosomal recessive retinitis pigmentosa.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21792939 2012 Galectin-3 is a new MerTK-specific eat-me signal.
21677792 2011 A novel MERTK deletion is a common founder mutation in the Faroe Islands and is responsible for a high proportion of retinitis pigmentosa cases.
21602930 2011 Detection of variants in 15 genes in 87 unrelated Chinese patients with Leber congenital amaurosis.
21542987 2011 Gene expression profile changes caused by the dysfunction of Mer during retinal pigment epithelium phagocytosis.
21496228 2011 Increased plasma levels of the soluble Mer tyrosine kinase receptor in systemic lupus erythematosus relate to disease activity and nephritis.
21384080 2011 Expression of the vitamin K-dependent proteins GAS6 and protein S and the TAM receptor tyrosine kinases in human atherosclerotic carotid plaques.
21347448 2011 Polymorphisms in the receptor tyrosine kinase MERTK gene are associated with multiple sclerosis susceptibility.
20978472 2010 Tubby and tubby-like protein 1 are new MerTK ligands for phagocytosis.
20959443 2010 Ectosomes released by polymorphonuclear neutrophils induce a MerTK-dependent anti-inflammatory pathway in macrophages.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
20664904 2010 Association study between polymorphims in GAS6-TAM genes and carotid atherosclerosis.
20654219 2010 [The relationship between MERTK gene and protein kinase C in the phagocytic process of human retinal pigment epithelial cells].
20637106 2010 TAM receptor ligands in lupus: protein S but not Gas6 levels reflect disease activity in systemic lupus erythematosus.
20591486 2010 Development of a diagnostic genetic test for simplex and autosomal recessive retinitis pigmentosa.
20546121 2010 Potentiating role of Gas6 and Tyro3, Axl and Mer (TAM) receptors in human and murine platelet activation and thrombus stabilization.
20538656 2010 Nonsense mutation in MERTK causes autosomal recessive retinitis pigmentosa in a consanguineous Pakistani family.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20300561 2010 Novel mutations in MERTK associated with childhood onset rod-cone dystrophy.
20130272 2010 A novel nonsense mutation in CEP290 induces exon skipping and leads to a relatively mild retinal phenotype.
20103767 2010 TNF-alpha, IL-6, and IL-1 expression is inhibited by GAS6 in monocytes/macrophages.
19922767 2010 GAS6/Mer axis regulates the homing and survival of the E2A/PBX1-positive B-cell precursor acute lymphoblastic leukemia in the bone marrow niche.
19541935 2009 Up-regulation of soluble Axl and Mer receptor tyrosine kinases negatively correlates with Gas6 in established multiple sclerosis lesions.
19403518 2009 Characterisation of severe rod-cone dystrophy in a consanguineous family with a splice site mutation in the MERTK gene.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19204785 2009 Molecular characterization and functional analysis of phagocytosis by human embryonic stem cell-derived RPE cells using a novel human retinal assay.
18922854 2009 Human protein S inhibits the uptake of AcLDL and expression of SR-A through Mer receptor tyrosine kinase in human macrophages.
18815424 2008 Novel splice donor site mutation in MERTK gene associated with retinitis pigmentosa.
18620092 2008 TAM receptor tyrosine kinases: biologic functions, signaling, and potential therapeutic targeting in human cancer.
18587056 2008 Overexpression of apoptotic cell removal receptor MERTK in alveolar macrophages of cigarette smokers.
18421305 2008 Immunobiology of the TAM receptors.
18395422 2008 Endogenous Gas6 and Ca2+ -channel activation modulate phagocytosis by retinal pigment epithelium.
18250462 2008 Auto-oxidation and oligomerization of protein S on the apoptotic cell surface is required for Mer tyrosine kinase-mediated phagocytosis of apoptotic cells.
18246816 2007 [Effect of Mer overexpression on HMEC-1 cell angiogenesis and its mechanism].
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18039660 2008 Autophosphorylation docking site Tyr-867 in Mer receptor tyrosine kinase allows for dissociation of multiple signaling pathways for phagocytosis of apoptotic cells and down-modulation of lipopolysaccharide-inducible NF-kappaB transcriptional activation.
17626743 2007 [Expression of Mer on Jurkat cells and its anti-apoptosis effect].
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17047157 2007 A soluble form of the Mer receptor tyrosine kinase inhibits macrophage clearance of apoptotic cells and platelet aggregation.
17005688 2006 Tyro3 family-mediated cell entry of Ebola and Marburg viruses.
16837475 2007 MERTK polymorphisms associated with risk of haematological disorders among Korean SLE patients.
16737840 2006 Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.
16710167 2006 Screening of the MERTK gene for mutations in Japanese patients with autosomal recessive retinitis pigmentosa.
16675557 2006 Ectopic expression of the proto-oncogene Mer in pediatric T-cell acute lymphoblastic leukemia.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16288044 2005 Activated tyrosine kinase Ack1 promotes prostate tumorigenesis: role of Ack1 in polyubiquitination of tumor suppressor Wwox.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15733062 2005 Gas6 receptors Axl, Sky and Mer enhance platelet activation and regulate thrombotic responses.
15479819 2004 The C-mer gene is induced by Epstein-Barr virus immediate-early protein BRLF1.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15130911 2004 Mer receptor tyrosine kinase signaling participates in platelet function.
15111602 2004 MERTK arginine-844-cysteine in a patient with severe rod-cone dystrophy: loss of mutant protein function in transfected cells.
12920122 2003 An SH2 domain-dependent, phosphotyrosine-independent interaction between Vav1 and the Mer receptor tyrosine kinase: a mechanism for localizing guanine nucleotide-exchange factor action.
12768229 2003 Expression of growth arrest-specific gene 6 and its receptors in dysfunctional human renal allografts.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11727200 2002 Retinal dystrophy due to paternal isodisomy for chromosome 1 or chromosome 2, with homoallelism for mutations in RPE65 or MERTK, respectively.
11062461 2000 Mutations in MERTK, the human orthologue of the RCS rat retinal dystrophy gene, cause retinitis pigmentosa.
10343112 1999 Assignment of protooncogene MERTK (a.k.a. c-mer) to human chromosome 2q14.1 by in situ hybridization.
9160883 1997 Identification of Gas6 as a ligand for Mer, a neural cell adhesion molecule related receptor tyrosine kinase implicated in cellular transformation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8702477 1996 Identification of the major autophosphorylation sites of Nyk/Mer, an NCAM-related receptor tyrosine kinase.
8621659 1996 Characterization of Gas6, a member of the superfamily of G domain-containing proteins, as a ligand for Rse and Axl.
8086340 1994 Cloning and mRNA expression analysis of a novel human protooncogene, c-mer.
7688222 1993 Identification of protein-tyrosine kinase genes preferentially expressed in embryo stomach and gastric cancer.