Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.37
PubTator Score 17.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.100 1.6e-03
atypical teratoid / rhabdoid tumor 1.800 3.7e-02
intraductal papillary-mucinous adenoma (... -2.200 3.0e-03
intraductal papillary-mucinous carcinoma... -2.000 7.4e-03
interstitial cystitis 2.000 7.6e-05
invasive ductal carcinoma -2.300 2.8e-04
breast carcinoma -1.300 3.5e-17
ductal carcinoma in situ -1.200 3.9e-04
ulcerative colitis 1.600 2.0e-05
ovarian cancer 1.800 1.7e-02
dermatomyositis 1.100 2.9e-02

Protein-protein Interaction (3)

Gene RIF (4)

PMID Text
24073994 The G > A p.Q84X mutation in the MEOX1 is identified in Klippel-Feil syndrome.
23290072 We describe a multiplex consanguineous family in which isolated KFS maps to a single 17q21.31 locus that harbors a homozygous frameshift deletion in MEOX1; this deletion results in complete instability of the transcript
22567123 The results demonstrate that MEOX1 is a critical target gene and cofactor of PBX1 in ovarian cancers.
17764081 No mutations were identified in the PAX1 and MEOX1 exons or flanking intronic sequences, excluding them as likely causative genes for diaphanospondylodysostosis

AA Sequence

MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT      1 - 70
PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST     71 - 140
ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL    141 - 210
SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE                              211 - 254
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24073994 2013 Mutation in MEOX1 gene causes a recessive Klippel-Feil syndrome subtype.
23290072 2013 Mutations in MEOX1, encoding mesenchyme homeobox 1, cause Klippel-Feil anomaly.
22567123 2012 Identification of PBX1 target genes in cancer cells by global mapping of PBX1 binding sites.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17764081 2007 Diaphanospondylodysostosis: six new cases and exclusion of the candidate genes, PAX1 and MEOX1.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
15793308 2005 Hedgehog signaling induces cardiomyogenesis in P19 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15039437 2004 Disruption of Meox or Gli activity ablates skeletal myogenesis in P19 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11423130 2001 Homeodomain proteins Mox1 and Mox2 associate with Pax1 and Pax3 transcription factors.
9373945 1997 The human homeobox genes MSX-1, MSX-2, and MOX-1 are differentially expressed in the dermis and epidermis in fetal and adult skin.
7987315 1994 Isolation of a diverged homeobox gene, MOX1, from the BRCA1 region on 17q21 by solution hybrid capture.
7874108 1994 The detailed characterisation of a 400 kb cosmid walk in the BRCA1 region: identification and localisation of 10 genes including a dual-specificity phosphatase.