Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.60
PubTator Score 17.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 3.7e-02
breast carcinoma -1.300 3.5e-17
dermatomyositis 1.100 2.9e-02
ductal carcinoma in situ -1.200 3.9e-04
interstitial cystitis 2.000 7.6e-05
intraductal papillary-mucinous adenoma (... -2.200 3.0e-03
intraductal papillary-mucinous carcinoma... -2.000 7.4e-03
invasive ductal carcinoma -1.217 3.4e-02
ovarian cancer 1.800 1.7e-02
psoriasis 1.100 1.6e-03
ulcerative colitis 1.600 2.0e-05

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT      1 - 70
PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST     71 - 140
ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL    141 - 210
SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE                              211 - 254
//

Text Mined References (19)

PMID Year Title