Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.32
PubTator Score 2.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.900 5.4e-04
astrocytic glioma -1.200 2.9e-02
cutaneous lupus erythematosus -1.100 7.2e-04
psoriasis -3.500 1.2e-05
osteosarcoma -2.238 6.8e-04
chronic lymphosyte leukemia -1.100 4.0e-07
glioblastoma -1.300 7.5e-03
atypical teratoid / rhabdoid tumor -1.400 1.3e-03
medulloblastoma, large-cell -1.900 2.2e-04
tuberculosis 2.600 1.9e-06
pancreatic ductal adenocarcinoma liver m... -2.228 1.1e-03
lung cancer -2.000 1.2e-03
adult high grade glioma -1.400 3.4e-05
ovarian cancer -1.800 1.1e-10
axial spondyloarthropathy 1.300 2.3e-02

Gene RIF (1)

PMID Text
24098452 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-alpha, CCNJ, and MEGF9.

AA Sequence

MNGGAERAMRSLPSLGGLALLCCAAAAAAAAVASAASAGNVTGGGGAAGQVDASPGPGLRGEPSHPFPRA      1 - 70
TAPTAQAPRTGPPRATVHRPLAATSPAQSPETTPLWATAGPSSTTFQAPLGPSPTTPPAAERTSTTSQAP     71 - 140
TRPAPTTLSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSNSSVLPTPPATEAPSSPPPEYVCNCSVVG    141 - 210
SLNVNRCNQTTGQCECRPGYQGLHCETCKEGFYLNYTSGLCQPCDCSPHGALSIPCNSSGKCQCKVGVIG    211 - 280
SICDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGACLNCQENSKGNHCEECKEGFYQSPDATKECLRCP    281 - 350
CSAVTSTGSCSIKSSELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESG    351 - 420
ECINCLHNTTGFWCENCLEGYVHDLEGNCIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQ    421 - 490
TIFSVSTSENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNI    491 - 560
SFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA                                561 - 602
//

Text Mined References (8)

PMID Year Title
24098452 2013 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-?, CCNJ, and MEGF9.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9693030 1998 Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.