Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.22
PubTator Score 7.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 2.4e-04
psoriasis 6685 1.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.300 1.4e-03
osteosarcoma -1.783 2.4e-04

Gene RIF (6)

PMID Text
25100719 Knockdown of mediator complex subunit 7 (MED7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18976975 Knockdown of MED7 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 7 (MED7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18854154 Knockdown of mediator complex subunit 7 (MED7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MED7 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18187620 Knockdown of mediator complex subunit 7 (MED7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPM      1 - 70
QFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMME     71 - 140
VQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGH    141 - 210
RRDQIIEKDAALCVLIDEMNERP                                                   211 - 233
//

Text Mined References (25)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18391015 2008 MED1 phosphorylation promotes its association with mediator: implications for nuclear receptor signaling.
17709345 2007 Ubc9 fusion-directed SUMOylation identifies constitutive and inducible SUMOylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
14576168 2003 A mammalian homolog of Drosophila melanogaster transcriptional coactivator intersex is a subunit of the mammalian Mediator complex.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10377381 1999 Purification of transcription cofactor complex CRSP.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
9989412 1999 The transcriptional cofactor complex CRSP is required for activity of the enhancer-binding protein Sp1.
9671713 1998 Mammalian mediator of transcriptional regulation and its possible role as an end-point of signal transduction pathways.
9420330 1998 The Med proteins of yeast and their function through the RNA polymerase II carboxy-terminal domain.