Property Summary

NCBI Gene PubMed Count 27
PubMed Score 49.72
PubTator Score 29.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.1e-03
Breast cancer 3098 4.7e-02
Disease Target Count Z-score Confidence
Breast lipoma 1 5.75 2.9

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.100 4.7e-02
lung adenocarcinoma 1.200 1.1e-03

Gene RIF (19)

PMID Text
25735376 High expression of Med19 is associated with cisplatin resistance in non-small cell lung cancer cells.
24565852 Data show that the expression of Mediator of RNA polymerase II transcription subunit 19 (Med19) was increased in Osteosarcoma (OS) samples from patients compared to normal bone tissues.
23705783 High Med19 expression is associated with tongue cancer.
23276457 Med19 promotes bone metastasis and invasiveness of bladder urothelial carcinoma via bone morphogenetic protein 2.
23098456 High MED19 expression is associated with lung adenocarcinoma cell clone conformation, growth, and metastasis.
23076562 LCMR1 suppresses apoptosis in lung cancer cells and this effect is associated with multiple apoptosis-related proteins, including p53, Bax and Mcl-1.
22565189 Med19 functions in promoting cellular growth and may be a useful therapeutic target in malignant gastric carcinoma
21871180 MED19 serves as a novel proliferation regulator that promotes growth of prostate cancer cells.
21732059 The effect of downregulation of LCMR1 by lentivirus-mediated small hairpin RNA (shRNA) on colorectal cancer cell proliferation and tumorigenesis was explored.
21542455 MED19 played an important role in cell growth and cell cycle progression of human osteosarcoma cells.
21519921 MED19 is a novel proliferation regulator that promotes growth of lung cancer cells
21478038 Med19 is markedly up-regulated in bladder cancer tissues
21372827 results provide new evidence of an important role for Med19 in the development of hepatocellular carcinomas
21306606 LCMR1 was strongly overexpressed in NSCLC and its expression was significantly associated with clinical stage.
20890603 upregulated expression of Med19 was found in breast cancer tissues; Med19 expression was significantly associated with tumor grade
19049968 findings identify MED19/MED26 as a probable composite REST interface in Mediator and further clarify the mechanistic basis by which Mediator facilitates REST-imposed epigenetic restrictions on neuronal gene expression
18976975 Knockdown of MED19 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 19 (MED19) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18854154 Knockdown of mediator complex subunit 19 (MED19) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRE      1 - 70
LPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSS     71 - 140
FNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPD    141 - 210
RKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR                                        211 - 244
//

Text Mined References (34)

PMID Year Title
25735376 2015 Knockdown of Med19 suppresses proliferation and enhances chemo-sensitivity to cisplatin in non-small cell lung cancer cells.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24565852 2014 Mediator of RNA polymerase II transcription subunit 19 promotes osteosarcoma growth and metastasis and associates with prognosis.
23705783 2013 Disruption of mediator complex subunit 19 (Med19) inhibits cell growth and migration in tongue cancer.
23276457 2013 Med19 promotes bone metastasis and invasiveness of bladder urothelial carcinoma via bone morphogenetic protein 2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098456 2012 Mammalian mediator 19 mediates H1299 lung adenocarcinoma cell clone conformation, growth, and metastasis.
23076562 2012 Suppression of lung cancer metastasis-related protein 1 promotes apoptosis in lung cancer cells.
22565189 2012 Med19 promotes gastric cancer progression and cellular growth.
22531626 2012 Distinct alternative splicing patterns of mediator subunit genes during endothelial progenitor cell differentiation.
21871180 2011 Suppression of MED19 expression by shRNA induces inhibition of cell proliferation and tumorigenesis in human prostate cancer cells.
21732059 2012 Suppression of lung cancer metastasis-related protein 1 (LCMR1) inhibits the growth of colorectal cancer cells.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
21542455 2011 Knockdown of MED19 by lentivirus-mediated shRNA in human osteosarcoma cells inhibits cell proliferation by inducing cell cycle arrest in the G0/G1 phase.
21519921 2011 MED19 promotes proliferation and tumorigenesis of lung cancer.
21478038 Expression of Med19 in bladder cancer tissues and its role on bladder cancer cell growth.
21372827 2011 The role of Med19 in the proliferation and tumorigenesis of human hepatocellular carcinoma cells.
21306606 2011 Overexpression of LCMR1 is significantly associated with clinical stage in human NSCLC.
20890603 2011 Lentivirus-mediated inhibition of Med19 suppresses growth of breast cancer cells in vitro.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19049968 2009 MED19 and MED26 are synergistic functional targets of the RE1 silencing transcription factor in epigenetic silencing of neuronal gene expression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
14576168 2003 A mammalian homolog of Drosophila melanogaster transcriptional coactivator intersex is a subunit of the mammalian Mediator complex.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9417904 1997 Mapping and characterization of novel (CAG)n repeat cDNAs from adult human brain derived by the oligo capture method.