Property Summary

NCBI Gene PubMed Count 14
PubMed Score 172.62
PubTator Score 50.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -2.080 5.2e-05
ependymoma -1.200 4.2e-08
atypical teratoid / rhabdoid tumor -1.600 3.9e-06
primitive neuroectodermal tumor -1.500 2.5e-02
pancreatic ductal adenocarcinoma liver m... 1.056 1.1e-02
non-small cell lung cancer -1.203 1.3e-08
colon cancer -1.200 2.2e-02
lung cancer -1.200 3.6e-03
inflammatory breast cancer -1.400 4.0e-03
Pick disease -1.400 3.8e-05
invasive ductal carcinoma -1.400 1.3e-02
ulcerative colitis -1.100 1.9e-05

Gene RIF (7)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19416979 human c-NADP-ME exists mainly as a tetramer, whereas human m-NAD(P)-ME exists as a mixture of dimers and tetramers
19236308 Studies demonstrate that the Lys57 residue plays dual functional roles in the structural integrity of the allosteric site and in the subunit-subunit interaction at the dimer interface of m-NAD(P)-ME.
18959763 ATP inhibition is proposed to be determined by the electrostatic potential involving the positive charge on the side chain of Lys346

AA Sequence

MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEER      1 - 70
LQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPT     71 - 140
VGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLA    141 - 210
LYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFE    211 - 280
DFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVM    281 - 350
ALEKEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGA    351 - 420
FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNA    421 - 490
YVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHN    491 - 560
LASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV                              561 - 604
//

Text Mined References (16)

PMID Year Title
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19416979 2009 Functional roles of the tetramer organization of malic enzyme.
19236308 2009 Dual roles of Lys(57) at the dimer interface of human mitochondrial NAD(P)+-dependent malic enzyme.
18959763 2008 Influential factor contributing to the isoform-specific inhibition by ATP of human mitochondrial NAD(P)+-dependent malic enzyme: functional roles of the nucleotide binding site Lys346.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7818469 1994 Purification, cDNA cloning and heterologous expression of the human mitochondrial NADP(+)-dependent malic enzyme.
511162 1979 Mitochondrial malic enzyme (E.C.1.1.1.40) in human leukocytes: formal genetics and population genetics.