Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.96
PubTator Score 5.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.500 3.1e-07
psoriasis -1.300 4.5e-07
osteosarcoma -2.039 2.6e-06
posterior fossa group B ependymoma 2.100 2.0e-08
astrocytoma 1.500 4.5e-02
atypical teratoid/rhabdoid tumor 2.000 9.8e-06
adrenocortical carcinoma 1.358 7.5e-04
colon cancer -1.400 1.4e-03
lung cancer 1.400 5.4e-03
group 3 medulloblastoma 1.700 1.8e-03
ovarian cancer -1.200 2.3e-03

Gene RIF (2)

PMID Text
26337392 Authorse propose that MDM1 is a negative regulator of centriole duplication and that its function is mediated through microtubule binding.
18805803 Not associated with age-related retinal degeneration.

AA Sequence

MPVRFKGLSEYQRNFLWKKSYLSESCNSSVGRKYPWAGLRSDQLGITKEPSFISKRRVPYHDPQISKSLE      1 - 70
WNGAISESNVVASPEPEAPETPKSQEAEQKDVTQERVHSLEASRVPKRTRSHSADSRAEGASDVENNEGV     71 - 140
TNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAAN    141 - 210
QVFHNKSQFVPPFKGNSVIHETEYKRNFKGLSPVKEPKLRNDLRENRNLETVSPERKSNKIDDRLKLEAE    211 - 280
MELKDLHQPKRKLTPWKHQRLGKVNSEYRAKFLSPAQYLYKAGAWTHVKGNMPNQVKELREKAEFYRKRV    281 - 350
QGTHFSRDHLNQILSDSNCCWDVSSTTSSEGTVSSNIRALDLAGDPTSHKTLQKCPSTEPEEKGNIVEEQ    351 - 420
PQKNTTEKLGVSAPTIPVRRRLAWDTENTSEDVQKQPGEKEEEDDNEEEGDRKTGKQAFMGEQEKLDVRE    421 - 490
KSKADKMKEGSDSSVSSEKGGRLPTPKLRELGGIQRTHHDLTTPAVGGAVLVSPSKMKPPAPEQRKRMTS    491 - 560
QDCLETSKNDFTKKESRAVSLLTSPAAGIKTVDPLPLREDSEDNIHKFAEATLPVSKIPKYPTNPPGQLP    561 - 630
SPPHVPSYWHPSRRIQGSLRDPEFQHNVGKARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQTL    631 - 700
ARAKKRKENFWGKT                                                            701 - 714
//

Text Mined References (14)

PMID Year Title
26337392 2015 MDM1 is a microtubule-binding protein that negatively regulates centriole duplication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
18805803 2008 Age-related retinal degeneration (arrd2) in a novel mouse model due to a nonsense mutation in the Mdm1 gene.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
3182840 1988 A gene amplified in a transformed mouse cell line undergoes complex transcriptional processing and encodes a nuclear protein.