Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.39
PubTator Score 5.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 3.800 2.6e-02
group 4 medulloblastoma -1.100 1.1e-03
invasive ductal carcinoma -1.007 7.8e-04
lung cancer 1.300 3.1e-03
malignant mesothelioma 2.000 1.5e-07
medulloblastoma, large-cell -1.100 2.9e-04
ovarian cancer 1.600 4.3e-03
pancreatic cancer 1.600 4.6e-04
pancreatic carcinoma 1.600 4.6e-04
psoriasis 1.100 6.0e-04

Gene RIF (4)

AA Sequence

MDCGSVGGQRTQRLPGRQRLLFLPVGLSGRPGGSETSARRCLSALSDGLGALRPRAPAARGGVSRASPLL      1 - 70
LLLLVPSPRLAAAAPRRQLGDWERSRLGYAAPPAGRSSAWRCSPGVAAAAGALPQYHGPAPALVSCRREL     71 - 140
SLSAGSLQLERKRRDFTSSGSRKLYFDTHALVCLLEDNGFATQQAEIIVSALVKILEANMDIVYKDMVTK    141 - 210
MQQEITFQQVMSQIANVKKDMIILEKSEFSALRAENEKIKLELHQLKQQVMDEVIKVRTDTKLDFNLEKS    211 - 280
RVKELYSLNEKKLLELRTEIVALHAQQDRALTQTDRKIETEVAGLKTMLESHKLDNIKYLAGSIFTCLTV    281 - 350
ALGFYRLWI                                                                 351 - 359
//

Text Mined References (15)

PMID Year Title