Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.30

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q4G0Z9 B4DYZ3 B4DZM4 B4E293 Q6P533 Q7Z3P4
Symbols C8orf45

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

 Compartment GO Term (3)

AA Sequence

MSNLKMKEAALIYLDRSGGLQKFIDDCKYYNDSKQSYAVYRFKILINPSDVVELDAELGNHILHQPLKAA      1 - 70
EVFQSVCFIAVKTLSLIGQLQTETQINIVLKLTHLPPLPSYGLDLCEFPLDYTSQRFYMMQGIVIAMTTI     71 - 140
TKYTQGARFLCSDEACPLSKGFQYIRVHVPGATESATIRNDFLCNLCASSLQEDRKFRVLGDKQIVEIIA    141 - 210
TKALRAFQGYSNNQPFRFQSLTIFLRDESVNKMNIGNEYKIIGIPTCVKTSQTAVCIEANSITFCNSKVP    211 - 280
SGISDNFRCLLSLTSSSCWKFTAILANIFASQITPPGTYNLLKLCLLMSLVQTTDRNKELEDCLDILIIT    281 - 350
SDTLLIDRLLNFSINLVPRGIRHLVSTEIFPTLSRNKYGTGAVSIQAGSALLAKGGICFIGDLASHKKDK    351 - 420
LEQLQTVLESRSITVYIPGKKFGEDIDQQMTFPVQCSFWSFVDVDSSSRRNAQKINTLIGQMDCSLIPAN    421 - 490
LVEAFGLLINCNESSPCHPFLPTVQHTLNKAINPEGLFYAASRQFTTEDFEKLLAFAKNLNVEFSLEAER    491 - 560
MTHGYYLASRRIRTGSVCGSKLSASALKYLVFLSEAHARLNLRNKVLKEDVLIAALLFETSLTLKYGATV    561 - 630
FCVAPNAVFPFELYNEEYLEQRDLYLTQCQQQLEQFIATYGPGTTIFSSDE                       631 - 681
//

Text Mined References (6)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.