Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.64
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
OVARIAN DYSGENESIS 4 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 7.3e-10
group 3 medulloblastoma 4104 6.4e-04
aldosterone-producing adenoma 665 9.6e-03
lung cancer 4740 1.0e-02
ovarian cancer 8520 1.1e-02
Breast cancer 3578 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Premature ovarian failure 65 4.915 2.5
Disease Target Count
Premature ovarian failure 1 2

Expression

  Differential Expression (6)

Disease log2 FC p
aldosterone-producing adenoma -1.160 9.6e-03
Breast cancer 2.200 3.9e-02
group 3 medulloblastoma 1.200 6.4e-04
lung cancer -1.100 1.0e-02
osteosarcoma -2.488 7.3e-10
ovarian cancer 1.200 1.1e-02

Gene RIF (11)

AA Sequence

MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFD      1 - 70
SALRRSALTILQSLSQPEAVSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLE     71 - 140
FERDYMCNKCKHVFVIKADFEQYYTFCRPSSCPSLESCDSSKFTCLSGLSSSPTRCRDYQEIKIQEQVQR    141 - 210
LSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGIVMQRWKPFQQDVRCEVEIVLKANYIQVNNEQSSGIIM    211 - 280
DEEVQKEFEDFWEYYKSDPFAGRNVILASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLL    281 - 350
VGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLK    351 - 420
EHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLLSRFDLILVLL    421 - 490
DTKNEDWDRIISSFILENKGYPSKSEKLWSMEKMKTYFCLIRNLQPTLSDVGNQVLLRYYQMQRQSDCRN    491 - 560
AARTTIRLLESLIRLAEAHARLMFRDTVTLEDAITVVSVMESSMQGGALLGGVNALHTSFPENPGEQYQR    561 - 630
QCELILEKLELQSLLSEELRRLERLQNQSVHQSQPRVLEVETTPGSLRNGPGEESNFRTSSQQEINYSTH    631 - 700
IFSPGGSPEGSPVLDPPPHLEPNRSTSRKHSAQHKNNRDDSLDWFDFMATHQSEPKNTVVVSPHPKTSGE    701 - 770
NMASKISNSTSQGKEKSEPGQRSKVDIGLLPSPGETGVPWRADNVESNKKKRLALDSEAAVSADKPDSVL    771 - 840
THHVPRNLQKLCKERAQKLCRNSTRVPAQCTVPSHPQSTPVHSPDRMLDSPKRKRPKSLAQVEEPAIENV    841 - 910
KPPGSPVAKLAKFTFKQKSKLIHSFEDHSHVSPGATKIAVHSPKISQRRTRRDAALPVKRPGKLTSTPGN    911 - 980
QISSQPQGETKEVSQQPPEKHGPREKVMCAPEKRIIQPELELGNETGCAHLTCEGDKKEEVSGSNKSGKV    981 - 1050
HACTLARLANFCFTPPSESKSKSPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESL   1051 - 1120
FTLPELGDEAFDCDWDEEMRKKS                                                  1121 - 1143
//

Text Mined References (24)

PMID Year Title