Property Summary

NCBI Gene PubMed Count 68
PubMed Score 90.29
PubTator Score 65.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.512 1.9e-05
atypical teratoid/rhabdoid tumor 1.200 1.5e-05
Breast cancer 2.200 3.5e-02
colon cancer 1.500 5.4e-03
Endometriosis 1.301 3.5e-02
esophageal adenocarcinoma 1.100 1.9e-02
group 3 medulloblastoma 1.600 2.4e-04
intraductal papillary-mucinous carcinoma... 1.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.100 4.3e-02
lung adenocarcinoma 1.400 4.6e-09
lung cancer 2.400 2.2e-04
malignant mesothelioma 1.300 9.0e-07
medulloblastoma, large-cell 1.400 2.7e-06
Multiple myeloma 1.017 3.8e-02
nasopharyngeal carcinoma 1.300 6.2e-05
non-small cell lung cancer 1.533 2.1e-28
osteosarcoma -2.535 2.6e-07
ovarian cancer 1.300 2.0e-02
primary Sjogren syndrome 1.100 2.5e-02
primitive neuroectodermal tumor 1.200 1.8e-02
psoriasis 1.100 3.2e-13
tuberculosis -1.400 5.9e-07
Waldenstrons macroglobulinemia 1.976 1.1e-02

Gene RIF (23)

AA Sequence

MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQ      1 - 70
FNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTRHKIRELTSSRIGLLTRISGQ     71 - 140
VVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQE    141 - 210
TQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEG    211 - 280
IRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNL    281 - 350
CTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS    351 - 420
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVK    421 - 490
ATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRIE    491 - 560
ESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKHLRQRDGSGVTKSSWRITVRQLESMIRLSEA    561 - 630
MARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYN    631 - 700
EDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKK    701 - 770
RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED                       771 - 821
//

Text Mined References (80)

PMID Year Title