Property Summary

NCBI Gene PubMed Count 74
PubMed Score 84.13
PubTator Score 50.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 2.000 1.5e-07
psoriasis -1.700 4.0e-04
osteosarcoma 1.801 3.2e-02
glioblastoma 1.700 2.8e-03
group 3 medulloblastoma 2.100 1.5e-04
atypical teratoid / rhabdoid tumor 1.600 6.4e-05
medulloblastoma, large-cell 2.800 6.4e-05
primitive neuroectodermal tumor 1.500 3.9e-04
adrenocortical carcinoma 1.312 5.4e-04
non-small cell lung cancer 2.484 7.0e-26
intraductal papillary-mucinous carcinoma... 1.400 7.1e-04
intraductal papillary-mucinous neoplasm ... 1.700 9.2e-04
lung cancer 2.800 1.5e-05
colon cancer 1.400 4.1e-03
Breast cancer 2.700 4.2e-02
pediatric high grade glioma 1.600 1.3e-05
lung adenocarcinoma 1.700 1.2e-08
nasopharyngeal carcinoma 1.300 3.3e-05
Endometriosis 1.278 1.5e-02
breast carcinoma 1.400 5.5e-28
ductal carcinoma in situ 1.300 3.8e-03
invasive ductal carcinoma 1.400 4.1e-03
ovarian cancer 1.500 1.2e-04

Gene RIF (27)

PMID Text
26188903 We did not find any evidence of augmented response to a short-term (48 h) cisplatin treatment in these MCM4-deficient cells. However, MCM4-/HPV16+ SiHa cells cannot withstand a prolonged treatment (up to 5 days) of even a sublethal dosage of cisplatin
25733866 Mutant p53 depletion profoundly influenced PARP1 localization and increased the level of PCNA and MCM4 proteins.
25661590 Purified MCM4/6/7 complex containing the G364R MCM4 exhibited similar levels of single-stranded DNA binding and ATPase activities to the complex containing wild-type MCM4
24386425 Of the total, the deregulation of several genes (CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a and RPN2) were potentially associated with disease development and progression.
23264620 Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells
22918583 Mcm2-7 loads onto origins during initiation as a double hexamer, yet does not act as a double-stranded DNA pump during elongation.
22668557 point mutation of MCM4 perturbs proper interaction with MCM6 to affect complex formation of MCM4/6/7 that is a core structure of MCM2-7 complex
22499342 Mutations in MCM4/PRKDC represent a novel cause of DNA breakage and NK cell deficiency.
22354170 MCM4 mutation may have a role in adrenal failure, short stature, and natural killer cell deficiency
22354167 partial MCM4 deficiency results in a genetic syndrome of growth retardation with adrenal insufficiency and selective NK deficiency
22190034 HIV-1 Pol is identified to have a physical interaction with minichromosome maintenance complex component 4 (MCM4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22160829 Widdrol breaks DNA directly in HT29 cells, resulting in checkpoint activation via Chk2-p53-Cdc25A-p21-MCM4 pathway and finally cells go to G1-phase cell cycle arrest and apoptosis.
20884074 higher expression in non-small cell lung cancer
20800603 Observational study of gene-disease association. (HuGE Navigator)
20508983 Observational study of gene-disease association. (HuGE Navigator)
20398247 MCM4 did not predict patient survival in this series of cutaneous melanomas.
20333247 the ability of cytomegalovirus to delay the accumulation of the mini-chromosome maintenance (MCM) complex proteins, represented by MCM2 and MCM4, and prevent their loading onto chromatin, was compromised in the absence of pUL117
19773279 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19053250 Sequence alignment of archaeal MCMs and MCM4 from Homo sapiens and Saccharomyces cerevisiae shows that Aeropyrum pernix MCM shares 32% identity with human and yeast MCM4.
18190532 Data show that two fragments (148-441 and 442-676) from the central region of MCM2 were mainly responsible for the interaction between MCM2 and MCM4, and this was revealed by a pulldown analysis using MCM4 protein beads.
17222376 The positive rate of MCM4 was significantly higher in stage T3 than in stage T1 esophageal cancer.
17046832 MCM4 phosphorylation by Cdc7 kinase facilitates its interaction with Cdc45 on chromatin
17005684 Expression of EBV-protein kinase caused phosphorylation of Thr-19 & Thr-110 on MCM4
16519687 These results suggest that phosphorylation of MCM4 has several distinct and site-specific roles in the function of MCM during the mammalian cell cycle.
15037254 HU- or UV irradiation-stimulated phosphorylation of MCM4 at several CDK sites led to inhibition of MCM4 helicase activity, consistent with the notion that the phosphorylation of MCM4 is involved in regulation of DNA synthesis in the checkpoint control.
12714602 the phosphorylation of MCM4 in the checkpoint control inhibits DNA replication, which includes blockage of DNA fork progression, through inactivation of the MCM complex

AA Sequence

MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFS      1 - 70
SPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIV     71 - 140
ASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNV    141 - 210
NCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDID    211 - 280
QLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQ    281 - 350
MIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH    351 - 420
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRK    421 - 490
DFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQT    491 - 560
GALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTT    561 - 630
IENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMP    631 - 700
RLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALK    701 - 770
QSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF    771 - 840
EEALRALADDDFLTVTGKTVRLL                                                   841 - 863
//

Text Mined References (85)

PMID Year Title
26188903 2015 HPV-type-specific response of cervical cancer cells to cisplatin after silencing replication licensing factor MCM4.
25733866 2015 Proteome-wide analysis of mutant p53 targets in breast cancer identifies new levels of gain-of-function that influence PARP, PCNA, and MCM4.
25661590 2015 G364R mutation of MCM4 detected in human skin cancer cells affects DNA helicase activity of MCM4/6/7 complex.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24386425 2013 Microarray gene expression analysis of tumorigenesis and regional lymph node metastasis in laryngeal squamous cell carcinoma.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
23764002 2013 Epidermal growth factor receptor potentiates MCM7-mediated DNA replication through tyrosine phosphorylation of Lyn kinase in human cancers.
23264620 2013 Peroxisome proliferator-activated receptor ? coactivator 1? (PGC-1?) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22918583 2012 The eukaryotic Mcm2-7 replicative helicase.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22668557 2012 Effect of an MCM4 mutation that causes tumours in mouse on human MCM4/6/7 complex formation.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22499342 2012 Recessive mutations in MCM4/PRKDC cause a novel syndrome involving a primary immunodeficiency and a disorder of DNA repair.
22354170 2012 MCM4 mutation causes adrenal failure, short stature, and natural killer cell deficiency in humans.
22354167 2012 Partial MCM4 deficiency in patients with growth retardation, adrenal insufficiency, and natural killer cell deficiency.
22190034 2011 Global landscape of HIV-human protein complexes.
22160829 2012 Widdrol activates DNA damage checkpoint through the signaling Chk2-p53-Cdc25A-p21-MCM4 pathway in HT29 cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20884074 2011 Minichromosome maintenance (MCM) protein 4 as a marker for proliferation and its clinical and clinicopathological significance in non-small cell lung cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20398247 2010 Ki-67 expression is superior to mitotic count and novel proliferation markers PHH3, MCM4 and mitosin as a prognostic factor in thick cutaneous melanoma.
20333247 2010 Human cytomegalovirus protein pUL117 targets the mini-chromosome maintenance complex and suppresses cellular DNA synthesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19053250 2008 Biochemical characterization of the minichromosome maintenance (MCM) protein of the crenarchaeote Aeropyrum pernix and its interactions with the origin recognition complex (ORC) proteins.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18190532 2008 Biochemical characterization of fragmented human MCM2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17296731 2007 Identification and characterization of a novel component of the human minichromosome maintenance complex.
17222376 2007 [Expression and significance of MCM4 in esophageal cancer].
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17046832 2006 Phosphorylation of MCM4 by Cdc7 kinase facilitates its interaction with Cdc45 on the chromatin.
17005684 2006 Phosphorylation of MCM4 at sites inactivating DNA helicase activity of the MCM4-MCM6-MCM7 complex during Epstein-Barr virus productive replication.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16902406 2006 Functional cooperation between FACT and MCM helicase facilitates initiation of chromatin DNA replication.
16899510 2006 Essential role of phosphorylation of MCM2 by Cdc7/Dbf4 in the initiation of DNA replication in mammalian cells.
16519687 2006 Site-specific phosphorylation of MCM4 during the cell cycle in mammalian cells.
16517729 2006 Signaling through mutants of the IgA receptor CD89 and consequences for Fc receptor gamma-chain interaction.
16341674 2005 Transcriptome analysis of human gastric cancer.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15236977 2004 Pairwise interactions of the six human MCM protein subunits.
15232106 2004 Self-assembling protein microarrays.
15226314 2004 Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures.
15081408 2004 MCM4 shares homology to a replication/DNA-binding domain in CTF and is contacted by pRb.
15037254 Levels of MCM4 phosphorylation and DNA synthesis in DNA replication block checkpoint control.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12771218 2003 A new member of the MCM protein family encoded by the human MCM8 gene, located contrapodal to GCD10 at chromosome band 20p12.3-13.
12714602 2003 Identification of MCM4 as a target of the DNA replication block checkpoint system.
12694531 2003 Mammalian Mcm2/4/6/7 complex forms a toroidal structure.
12614612 2003 Interaction and assembly of murine pre-replicative complex proteins in yeast and mouse cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364596 2002 Human Mcm proteins at a replication origin during the G1 to S phase transition.
12207017 2002 Roles of Mcm7 and Mcm4 subunits in the DNA helicase activity of the mouse Mcm4/6/7 complex.
12045100 2002 DNA replication in eukaryotic cells.
11931757 2002 Human origin recognition complex large subunit is degraded by ubiquitin-mediated proteolysis after initiation of DNA replication.
11454864 2001 Phosphorylation of Mcm4 at specific sites by cyclin-dependent kinase leads to loss of Mcm4,6,7 helicase activity.
11136247 2001 Processive DNA helicase activity of the minichromosome maintenance proteins 4, 6, and 7 complex requires forked DNA structures.
11095689 2000 The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase.
10846177 2000 Human Cdc7-related kinase complex. In vitro phosphorylation of MCM by concerted actions of Cdks and Cdc7 and that of a criticial threonine residue of Cdc7 bY Cdks.
10748114 2000 Inhibition of Mcm4,6,7 helicase activity by phosphorylation with cyclin A/Cdk2.
10567526 1999 Biochemical analysis of the intrinsic Mcm4-Mcm6-mcm7 DNA helicase activity.
10436018 1999 The Cdc6 nucleotide-binding site regulates its activity in DNA replication in human cells.
9642275 1998 Cell cycle- and chromatin binding state-dependent phosphorylation of human MCM heterohexameric complexes. A role for cdc2 kinase.
9465298 1998 The promoters for human DNA-PKcs (PRKDC) and MCM4: divergently transcribed genes located at chromosome 8 band q11.
9305914 1997 A DNA helicase activity is associated with an MCM4, -6, and -7 protein complex.
9284934 1997 MCM4 and PRKDC, human genes encoding proteins MCM4 and DNA-PKcs, are close neighbours located on chromosome 8q12-->q13.
8798650 1996 Binding of human minichromosome maintenance proteins with histone H3.
8631321 1996 Properties of the human nuclear protein p85Mcm. Expression, nuclear localization and interaction with other Mcm proteins.
8265339 1993 The P1 family: a new class of nuclear mammalian proteins related to the yeast Mcm replication proteins.
7601140 1995 A human homologue of the yeast replication protein Cdc21. Interactions with other Mcm proteins.